KEGG   Oryctolagus cuniculus (rabbit): 100008969
Entry
100008969         CDS       T03373                                 

Symbol
AICDA
Name
(RefSeq) activation induced cytidine deaminase
  KO
K10989  activation-induced cytidine deaminase [EC:3.5.4.38]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04672  Intestinal immune network for IgA production
ocu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100008969 (AICDA)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    100008969 (AICDA)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.38  single-stranded DNA cytosine deaminase
     100008969 (AICDA)
SSDB
Motif
Pfam: APOBEC2 NAD1 APOBEC_N NAD2 SNAD4 APOBEC3 APOBEC_C APOBEC4_like APOBEC4 APOBEC1 RbcX
Other DBs
NCBI-GeneID: 100008969
NCBI-ProteinID: XP_017199096
Ensembl: ENSOCUG00000023739
LinkDB
Position
8
AA seq 206 aa
MPQTRSSPLVLLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSFSLDFGYLRNT
NGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVADFLRGNPNLTLRIFTAR
LYFCEDRKAEPEGLRRLHQAGVQLGIMTFKDYFYCWNTFVENRERTFKAWEGLHENSVRL
SRQLRRILLPLYEVDDLRDAFRTLGL
NT seq 621 nt   +upstreamnt  +downstreamnt
atgccgcagacccgctcctcgccgctggtcctccttttgatgaagcagaagaagtttctt
tatcacttcaagaatgtccgctgggctaagggccggcacgagacctacctgtgctacgtg
gtcaagcggcgggacagtgccacctccttctcactggacttcggctacctgcgcaacacg
aacggctgccacgtggaattgctcttcctccgctacatctccgactgggacctggacccc
ggccgctgctaccgcgtcacctggttcacctcctggagcccttgctacgactgtgcccgg
cacgtggctgacttcctgagaggcaaccccaacctcactctgaggatcttcaccgcgcgc
ctctacttctgcgaggaccgcaaggccgagcccgagggactgcggcggctgcaccaagcg
ggcgtccagctcggcatcatgaccttcaaagattatttttactgctggaatactttcgtg
gagaaccgtgagagaacgttcaaggcctgggaaggcctgcatgaaaattctgtccgcctg
tccagacagctccggcgcatccttctgcccctttatgaggtcgatgacctacgagatgcg
tttcgtactttgggactttga

DBGET integrated database retrieval system