KEGG   Oryctolagus cuniculus (rabbit): 100008998
Entry
100008998         CDS       T03373                                 

Symbol
CD28
Name
(RefSeq) CD28 molecule
  KO
K06470  CD28 antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04660  T cell receptor signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu04940  Type I diabetes mellitus
ocu05162  Measles
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05320  Autoimmune thyroid disease
ocu05322  Systemic lupus erythematosus
ocu05323  Rheumatoid arthritis
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100008998 (CD28)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100008998 (CD28)
   04672 Intestinal immune network for IgA production
    100008998 (CD28)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100008998 (CD28)
  09172 Infectious disease: viral
   05162 Measles
    100008998 (CD28)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100008998 (CD28)
   05323 Rheumatoid arthritis
    100008998 (CD28)
   05320 Autoimmune thyroid disease
    100008998 (CD28)
   05330 Allograft rejection
    100008998 (CD28)
   05332 Graft-versus-host disease
    100008998 (CD28)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100008998 (CD28)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100008998 (CD28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100008998 (CD28)
CD molecules [BR:ocu04090]
 Proteins
  100008998 (CD28)
SSDB
Motif
Pfam: V-set_2 V-set CMV_1a_C
Other DBs
NCBI-GeneID: 100008998
NCBI-ProteinID: NP_001075676
Ensembl: ENSOCUG00000016134
UniProt: P42069
LinkDB
Position
7
AA seq 221 aa
MILRLLLAFNFFPSIQGTENKILVKQSPMLVVNNNEVNLSCKYTYNLFSKEFRASLYKGA
DSAVEVCVVNGNFSHPHQFHSTTGFNCDGKLGNETVTFYLKNLYVNQTDIYFCKIEVMYP
PPYLDNEKSNGTIIHVKEQHFCPAHPSPKSSTLFWVLVVVGAVLAFYSMLVTVALFSCWM
KSKKNRLLQSDYMNMTPRRPGPTRKHYQPYAPARDFAAYRS
NT seq 666 nt   +upstreamnt  +downstreamnt
atgattctcaggctgctcttggctttcaacttcttcccctcaattcaaggaacagagaac
aagattttggtgaagcagtctcccatgcttgtggtgaataacaacgaggtcaacctgagc
tgcaagtatacctacaacctcttctccaaggagttccgggcatccctctataagggagct
gacagtgctgtggaggtctgtgtcgtgaatgggaacttctcccatccacatcagtttcat
tcaactacagggttcaactgtgatggaaaattgggcaatgaaacagtgactttctacctc
aagaatctgtacgttaaccaaacagatatttacttctgcaaaatcgaggtcatgtaccct
cctccttatctagacaacgagaagagcaacggaacaattatccacgtgaaagagcaacat
ttttgcccagctcacccatctccaaaatcatcgacgctcttttgggttctggtggtggtt
ggcgcagtcctggctttctatagcatgctggtgacagtggcccttttttcttgctggatg
aagagtaagaagaacaggctccttcagagtgactacatgaatatgactccccggaggcct
gggcccacccgcaagcactaccagccctacgctccagcacgagacttcgcagcctaccgc
tcctga

DBGET integrated database retrieval system