Oryctolagus cuniculus (rabbit): 100009039 Help Entry 100009039         CDS       T03373                                  Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01522   Endocrine resistance ocu04110   Cell cycle ocu04115   p53 signaling pathway ocu04151   PI3K-Akt signaling pathway ocu04218   Cellular senescence ocu04530   Tight junction ocu04660   T cell receptor signaling pathway ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04934   Cushing syndrome ocu05160   Hepatitis C ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05165   Human papillomavirus infection ocu05166   Human T-cell leukemia virus 1 infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05169   Epstein-Barr virus infection ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05212   Pancreatic cancer ocu05214   Glioma ocu05218   Melanoma ocu05219   Bladder cancer ocu05220   Chronic myeloid leukemia ocu05222   Small cell lung cancer ocu05223   Non-small cell lung cancer ocu05224   Breast cancer ocu05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     100009039  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     100009039    04115 p53 signaling pathway     100009039    04218 Cellular senescence     100009039   09144 Cellular community - eukaryotes    04530 Tight junction     100009039  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     100009039  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100009039    05203 Viral carcinogenesis     100009039   09162 Cancer: specific types    05212 Pancreatic cancer     100009039    05225 Hepatocellular carcinoma     100009039    05214 Glioma     100009039    05220 Chronic myeloid leukemia     100009039    05218 Melanoma     100009039    05219 Bladder cancer     100009039    05224 Breast cancer     100009039    05222 Small cell lung cancer     100009039    05223 Non-small cell lung cancer     100009039   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100009039    05160 Hepatitis C     100009039    05164 Influenza A     100009039    05162 Measles     100009039    05163 Human cytomegalovirus infection     100009039    05167 Kaposi sarcoma-associated herpesvirus infection     100009039    05169 Epstein-Barr virus infection     100009039    05165 Human papillomavirus infection     100009039   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100009039    04934 Cushing syndrome     100009039   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100009039  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     100009039 Enzymes [BR:ocu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      100009039 Protein kinases [BR:ocu01001]  Serine/threonine kinases: CMGC group   CDK family    100009039 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo Haspin_kinase ABC1 Kinase-like Motif Other DBs NCBI-GeneID:  100009039 NCBI-ProteinID:  XP_002720970 UniProt:  G1T3E1 LinkDB All DBs Position Unknown AA seq 303 aa AA seqDB search MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSSGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSAGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRAAFSPRGPRPVQSVVPELEESGAQLLLEMLTFSPHKRISACRALQHSYLHKEEG GPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctacctctcgctacgagcctgtagctgaaattggtgtcggtgcctacgggacggtg tacaaggcccgggacccccacagtggccactttgtggccctcaagagcgtgcgagtcccc aatggaggaggcgctggagggggccttcccatcagcactgttcgcgaggtggctttactc aggcggctggaggcctttgagcaccccaatgttgtccggctgatggacgtctgtgccacc tcccgaaccgaccgggaaatcaaggtgaccctggtgtttgagcacgtcgaccaagaccta aggacgtatctggacaaggcacccccaccaggcctgccggcagagaccatcaaggatctg atgcgccagtttcttagaggcctggatttccttcatgccaattgcatcgtccaccgagac ctgaagccagagaatattctggtgacgagcagcgggacggtcaagctggctgacttcggc ctggctagaatctacagctaccagatggcgcttacacctgtggttgtgacgctctggtac cgtgctcctgaggttcttctgcagtctacatatgccacgcctgtggacatgtggagcgct ggctgtatctttgcagaaatgtttcgtcgaaagcctctcttctgtggaaactccgaagcc gaccagctgggcaaaatctttgacctgatcgggctgcctccggaagacgactggccccga gatgtgtcgctcccccgagcggccttctccccaagagggccccgcccagtgcagtcggtg gtgccggagctggaggagtccggagcgcagctgctgctggaaatgctgactttcagccca cacaagcggatctctgcctgcagagccctgcagcactcttacctccacaaggaagaaggc ggcccagagtga

DBGET integrated database retrieval system