Oryctolagus cuniculus (rabbit): 100009039 Help Entry 100009039         CDS       T03373                                  Symbol CDK4 Name (RefSeq) cyclin dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01522   Endocrine resistance ocu04110   Cell cycle ocu04115   p53 signaling pathway ocu04151   PI3K-Akt signaling pathway ocu04218   Cellular senescence ocu04530   Tight junction ocu04660   T cell receptor signaling pathway ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04934   Cushing syndrome ocu05160   Hepatitis C ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05165   Human papillomavirus infection ocu05166   Human T-cell leukemia virus 1 infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05169   Epstein-Barr virus infection ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05212   Pancreatic cancer ocu05214   Glioma ocu05218   Melanoma ocu05219   Bladder cancer ocu05220   Chronic myeloid leukemia ocu05222   Small cell lung cancer ocu05223   Non-small cell lung cancer ocu05224   Breast cancer ocu05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     100009039 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     100009039 (CDK4)    04115 p53 signaling pathway     100009039 (CDK4)    04218 Cellular senescence     100009039 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     100009039 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     100009039 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100009039 (CDK4)    05203 Viral carcinogenesis     100009039 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     100009039 (CDK4)    05225 Hepatocellular carcinoma     100009039 (CDK4)    05214 Glioma     100009039 (CDK4)    05220 Chronic myeloid leukemia     100009039 (CDK4)    05218 Melanoma     100009039 (CDK4)    05219 Bladder cancer     100009039 (CDK4)    05224 Breast cancer     100009039 (CDK4)    05222 Small cell lung cancer     100009039 (CDK4)    05223 Non-small cell lung cancer     100009039 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100009039 (CDK4)    05160 Hepatitis C     100009039 (CDK4)    05164 Influenza A     100009039 (CDK4)    05162 Measles     100009039 (CDK4)    05163 Human cytomegalovirus infection     100009039 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     100009039 (CDK4)    05169 Epstein-Barr virus infection     100009039 (CDK4)    05165 Human papillomavirus infection     100009039 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100009039 (CDK4)    04934 Cushing syndrome     100009039 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100009039 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     100009039 (CDK4) Enzymes [BR:ocu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      100009039 (CDK4) Protein kinases [BR:ocu01001]  Serine/threonine kinases: CMGC group   CDK family    100009039 (CDK4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo Haspin_kinase ABC1 Kinase-like FTA2 Motif Other DBs NCBI-GeneID:  100009039 NCBI-ProteinID:  XP_002720970 LinkDB All DBs Position Un Genome browser AA seq 303 aa AA seqDB search MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSSGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSAGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRAAFSPRGPRPVQSVVPELEESGAQLLLEMLTFSPHKRISACRALQHSYLHKEEG GPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctacctctcgctacgagcctgtagctgaaattggtgtcggtgcctacgggacggtg tacaaggcccgggacccccacagtggccactttgtggccctcaagagcgtgcgagtcccc aatggaggaggcgctggagggggccttcccatcagcactgttcgcgaggtggctttactc aggcggctggaggcctttgagcaccccaatgttgtccggctgatggacgtctgtgccacc tcccgaaccgaccgggaaatcaaggtgaccctggtgtttgagcacgtcgaccaagaccta aggacgtatctggacaaggcacccccaccaggcctgccggcagagaccatcaaggatctg atgcgccagtttcttagaggcctggatttccttcatgccaattgcatcgtccaccgagac ctgaagccagagaatattctggtgacgagcagcgggacggtcaagctggctgacttcggc ctggctagaatctacagctaccagatggcgcttacacctgtggttgtgacgctctggtac cgtgctcctgaggttcttctgcagtctacatatgccacgcctgtggacatgtggagcgct ggctgtatctttgcagaaatgtttcgtcgaaagcctctcttctgtggaaactccgaagcc gaccagctgggcaaaatctttgacctgatcgggctgcctccggaagacgactggccccga gatgtgtcgctcccccgagcggccttctccccaagagggccccgcccagtgcagtcggtg gtgccggagctggaggagtccggagcgcagctgctgctggaaatgctgactttcagccca cacaagcggatctctgcctgcagagccctgcagcactcttacctccacaaggaagaaggc ggcccagagtga

Oryctolagus cuniculus (rabbit): 100009040 Help Entry 100009040         CDS       T03373                                  Symbol CDK6 Name (RefSeq) cyclin dependent kinase 6   KO K02091   cyclin-dependent kinase 6 [EC:2.7.11.22] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04110   Cell cycle ocu04115   p53 signaling pathway ocu04151   PI3K-Akt signaling pathway ocu04218   Cellular senescence ocu04934   Cushing syndrome ocu05160   Hepatitis C ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05165   Human papillomavirus infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05169   Epstein-Barr virus infection ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05206   MicroRNAs in cancer ocu05212   Pancreatic cancer ocu05214   Glioma ocu05218   Melanoma ocu05220   Chronic myeloid leukemia ocu05222   Small cell lung cancer ocu05223   Non-small cell lung cancer ocu05224   Breast cancer ocu05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     100009040 (CDK6)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     100009040 (CDK6)    04115 p53 signaling pathway     100009040 (CDK6)    04218 Cellular senescence     100009040 (CDK6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100009040 (CDK6)    05206 MicroRNAs in cancer     100009040 (CDK6)    05203 Viral carcinogenesis     100009040 (CDK6)   09162 Cancer: specific types    05212 Pancreatic cancer     100009040 (CDK6)    05225 Hepatocellular carcinoma     100009040 (CDK6)    05214 Glioma     100009040 (CDK6)    05220 Chronic myeloid leukemia     100009040 (CDK6)    05218 Melanoma     100009040 (CDK6)    05224 Breast cancer     100009040 (CDK6)    05222 Small cell lung cancer     100009040 (CDK6)    05223 Non-small cell lung cancer     100009040 (CDK6)   09172 Infectious disease: viral    05160 Hepatitis C     100009040 (CDK6)    05164 Influenza A     100009040 (CDK6)    05162 Measles     100009040 (CDK6)    05163 Human cytomegalovirus infection     100009040 (CDK6)    05167 Kaposi sarcoma-associated herpesvirus infection     100009040 (CDK6)    05169 Epstein-Barr virus infection     100009040 (CDK6)    05165 Human papillomavirus infection     100009040 (CDK6)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     100009040 (CDK6)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     100009040 (CDK6) Enzymes [BR:ocu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      100009040 (CDK6) Protein kinases [BR:ocu01001]  Serine/threonine kinases: CMGC group   CDK family    100009040 (CDK6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH ABC1 Kdo Haspin_kinase Kinase-like RIO1 FTA2 Motif Other DBs NCBI-GeneID:  100009040 NCBI-ProteinID:  XP_002713851 Ensembl:  ENSOCUG00000011078 UniProt:  G1T0K2 LinkDB All DBs Position 10:35993872..36226222 Genome browser AA seq 326 aa AA seqDB search MEKDGLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALAHPYF QDLERGKESLDPHLPPSQSASELNTA NT seq 981 nt NT seq  +upstreamnt  +downstreamnt atggagaaggacggcctgagccgcgccgaccagcagtacgagtgcgtggcggagatcggg gagggcgcctacgggaaggtgttcaaggcccgcgacctcaagaacggaggccggttcgtg gcgctgaagcgcgtgcgggtgcagacgggcgaggaaggcatgccgctctccaccatccgc gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggctgttc gatgtatgcacagtgtcccggacagacagagagacaaagctaacactagtgtttgaacat gttgatcaagacttgaccacttacctggataaagttccggagcctggagtgcccactgaa actataaaggatatgatgtttcagctcctgcgaggtctggactttcttcattctcaccga gtagtgcatcgtgatctaaaaccacagaacattctggtgaccagcagtggacaaataaaa ctggctgacttcggccttgcgcgcatctacagttttcagatggctcttacttcagtggtc gtcacgctgtggtaccgagctccagaagtcctgctgcagtccagctacgccacgcccgtg gatctctggagtgtcggctgcatatttgcagaaatgtttcgtagaaagcctctctttcgt ggaagttcagatgtggatcagctaggaaaaatcttggacgtcattggactcccaggagaa gaggactggcccagagatgttgcccttcccaggcaagcgtttcattccaaatctgcccag ccgattgagaagttcgtaacagatatcgatgaactaggcaaagacctgcttctgaagtgc ttgaccttcaatccagccaaaagaatatctgcctacagcgccctggcccacccgtacttc caagacctggagaggggcaaggagagcttggatccccacctaccgcccagccagagcgcc tcagagctgaacacagcctga

Oryctolagus cuniculus (rabbit): 100134865 Help Entry 100134865         CDS       T03373                                  Symbol CDK2 Name (RefSeq) cyclin dependent kinase 2   KO K02206   cyclin-dependent kinase 2 [EC:2.7.11.22] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04068   FoxO signaling pathway ocu04110   Cell cycle ocu04114   Oocyte meiosis ocu04115   p53 signaling pathway ocu04151   PI3K-Akt signaling pathway ocu04218   Cellular senescence ocu04914   Progesterone-mediated oocyte maturation ocu04934   Cushing syndrome ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05165   Human papillomavirus infection ocu05166   Human T-cell leukemia virus 1 infection ocu05169   Epstein-Barr virus infection ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05215   Prostate cancer ocu05222   Small cell lung cancer ocu05226   Gastric cancer Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     100134865 (CDK2)    04151 PI3K-Akt signaling pathway     100134865 (CDK2)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     100134865 (CDK2)    04114 Oocyte meiosis     100134865 (CDK2)    04115 p53 signaling pathway     100134865 (CDK2)    04218 Cellular senescence     100134865 (CDK2)  09150 Organismal Systems   09152 Endocrine system    04914 Progesterone-mediated oocyte maturation     100134865 (CDK2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100134865 (CDK2)    05203 Viral carcinogenesis     100134865 (CDK2)   09162 Cancer: specific types    05226 Gastric cancer     100134865 (CDK2)    05215 Prostate cancer     100134865 (CDK2)    05222 Small cell lung cancer     100134865 (CDK2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100134865 (CDK2)    05161 Hepatitis B     100134865 (CDK2)    05160 Hepatitis C     100134865 (CDK2)    05162 Measles     100134865 (CDK2)    05169 Epstein-Barr virus infection     100134865 (CDK2)    05165 Human papillomavirus infection     100134865 (CDK2)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     100134865 (CDK2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     100134865 (CDK2)   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ocu03032]     100134865 (CDK2)    03036 Chromosome and associated proteins [BR:ocu03036]     100134865 (CDK2) Enzymes [BR:ocu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      100134865 (CDK2) Protein kinases [BR:ocu01001]  Serine/threonine kinases: CMGC group   CDK family    100134865 (CDK2) DNA replication proteins [BR:ocu03032]  Eukaryotic type   DNA Replication Initiation Factors    CDK (cyclin dependent kinase)     100134865 (CDK2) Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Centrosome formation proteins    Kinases and associated factors     100134865 (CDK2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 Haspin_kinase APH Kinase-like Motif Other DBs NCBI-GeneID:  100134865 NCBI-ProteinID:  XP_002711107 Ensembl:  ENSOCUG00000000998 UniProt:  A0A5F9C2I2 LinkDB All DBs Position 4:39516982..39523158 Genome browser AA seq 298 aa AA seqDB search MENFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS HRVLHRDLKPQNLLINAEGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY STAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSF PKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL NT seq 897 nt NT seq  +upstreamnt  +downstreamnt atggagaacttccaaaaggtggaaaagatcggagagggcacgtacggagtggtgtacaaa gccaaaaacaagctgacgggagaagtggtggcgctcaagaaaatccgcctggacactgag actgaaggtgtacccagcactgccatccgggagatctctctgcttaaggagcttaaccac cccaatattgtcaagctgctggatgtcatccacacggaaaacaaactttacctcgttttt gaattcctgcaccaagatctcaagaaattcatggatgcctctgctctcactggcattcct cttcccctcatcaagagctatctgttccagctgctccaaggcctagcgttctgccattct catcgggtcctgcaccgagatctaaaacctcagaatctacttatcaatgcagagggctcc atcaagttagccgactttggactagccagagcctttggagtgcctgttcgtacttacacc cacgaggtggtgaccctgtggtaccgagcccctgagatcctcctgggctgcaaatactac tccacagccgtggacatctggagcctgggctgcatctttgccgagatggtgacccgccgg gccctgttccctggtgattctgagattgaccagctcttccggatcttccggactctgggg accccagatgaggtggtttggccaggagttacttcaatgcccgattacaagccgagtttc cccaagtgggcccggcaggattttagcaaagtcgtgcctcccctggatgaagatggacgg agcttgttatcgcaaatgttgcactatgaccccaacaagcggatttcggcaaaggcagct ctggctcaccccttcttccaggatgtgaccaagccagtaccccatctccgactctaa

DBGET integrated database retrieval system