KEGG   Oryctolagus cuniculus (rabbit): 100009152
Entry
100009152         CDS       T03373                                 
Symbol
CD4
Name
(RefSeq) CD4 molecule
  KO
K06454  T-cell surface glycoprotein CD4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03250  Viral life cycle - HIV-1
ocu04060  Cytokine-cytokine receptor interaction
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04640  Hematopoietic cell lineage
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu05135  Yersinia infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    100009152 (CD4)
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100009152 (CD4)
   04514 Cell adhesion molecules
    100009152 (CD4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100009152 (CD4)
   04612 Antigen processing and presentation
    100009152 (CD4)
   04660 T cell receptor signaling pathway
    100009152 (CD4)
   04658 Th1 and Th2 cell differentiation
    100009152 (CD4)
   04659 Th17 cell differentiation
    100009152 (CD4)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100009152 (CD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100009152 (CD4)
   05170 Human immunodeficiency virus 1 infection
    100009152 (CD4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100009152 (CD4)
  09163 Immune disease
   05340 Primary immunodeficiency
    100009152 (CD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100009152 (CD4)
CD molecules [BR:ocu04090]
 Proteins
  100009152 (CD4)
SSDB
Motif
Pfam: CD4-extracel C2-set ig V-set Ig_3 Ig_2 I-set Tcell_CD4_C Receptor_2B4 Izumo-Ig Ig_6 zf-UBR
Other DBs
NCBI-GeneID: 100009152
NCBI-ProteinID: NP_001075782
Ensembl: ENSOCUG00000012911
UniProt: P46630
LinkDB
Position
8:32816573..32840063
AA seq 459 aa
MNRRIYFQCLLLVLPLALLPAATWGKTVVRGKAGAIVELPCQSSQKRNSVFNWKHANQVK
ILGNQGSSSSSFWLKGNSPLSNRVESKKNMWDQGSFPLVIKDLRMDDSGTYICEVGDKKM
EVELLVFRLTANPNTRLLHGQSLTLTLEGPSVGSPSVQWKSPENKIIETGPTCSMPKLRL
QDSGTWSCHLSFQDQNKLELDIKIIVLGFPKASATVYKKEGEQVEFSFPLNFEDESLSGE
LMWQVDGASSAQSWVSFSLEDRKVSVQKILPDLKIQMSKGLPLSLTLPQALHRYAGSGNL
SLTLDKGKLHQQVSLVMLKVTQVKNKLTCEVLGPIDPKMKLSLKLEDQEAKVSTQKMVQV
LDPKAGTWQCLLSSGDQVLLESKADVLATGLSHQQPTLLAGALGGTAGLVLFAGLCIYCC
VKCRHRRHQAQRMSQIKKLLSEKKTCQCPHRLQKTYNLL
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgaaccggagaatctacttccagtgcctgctgctggtgctgccgctggcactactccca
gcggccacctgggggaagaccgtggtgagaggcaaagccggagccatcgtggagctgccc
tgccagagttcccagaagaggaactcagtcttcaactggaaacatgcgaaccaggtcaag
atcctgggaaaccagggctcctcctcctcctccttctggcttaaagggaactccccgctg
agcaatcgcgttgaatccaaaaaaaacatgtgggaccaaggatctttccccctggtcatc
aaggatctcaggatggacgactcggggacttatatctgcgaagtgggggacaagaagatg
gaggtggaactgctggtgttcagattgactgccaacccgaacacccgcctgctacatgga
cagtcactgaccctcaccttggaaggcccctctgtggggagcccctccgtgcaatggaag
agtccagaaaataaaatcatagaaaccgggccgacttgctccatgcccaagctgaggctc
caggacagtggcacctggtcctgccacctgtcgttccaggaccagaacaaactggagtta
gacataaaaatcatagtgttgggctttccaaaagcctcggccacagtctacaagaaagag
ggggagcaggtggagttctctttcccgcttaacttcgaagacgaaagcctgagcggagag
ctcatgtggcaggtcgacggggcttcctcggcccagtcctgggtcagcttctccttggag
gacaggaaggtgtctgtgcagaagatcctccctgacctcaagatccagatgagcaagggg
ctcccgctcagcctcaccctgccccaggccctgcatcgctatgctggttccggaaacctg
agcctgacccttgataagggaaagttgcatcagcaagtgagcctggtgatgctgaaagtg
actcaggtaaagaacaagttgacttgtgaggtgctgggacccattgaccccaagatgaag
ctgagcttgaagctggaggaccaggaagcaaaggtctccacccagaagatggtgcaggtg
ctggaccccaaggcagggacctggcagtgtctgctgagcagtggggaccaggtgctgctg
gagtccaaggctgatgttttagccacgggactcagccaccagcagcccacactcctggct
ggcgcactggggggtaccgcgggccttgtactcttcgctgggctctgcatctactgctgt
gtcaagtgccggcaccgacggcatcaggcacagcggatgtctcagatcaagaagctgctc
agtgagaagaagacctgccagtgtccccaccggctgcagaagacttacaatctcctgtga

DBGET integrated database retrieval system