Oryctolagus cuniculus (rabbit): 100009292 Help Entry 100009292         CDS       T03373                                  Symbol TP53 Name (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01522   Endocrine resistance ocu01524   Platinum drug resistance ocu04010   MAPK signaling pathway ocu04071   Sphingolipid signaling pathway ocu04110   Cell cycle ocu04115   p53 signaling pathway ocu04137   Mitophagy - animal ocu04151   PI3K-Akt signaling pathway ocu04210   Apoptosis ocu04211   Longevity regulating pathway ocu04216   Ferroptosis ocu04218   Cellular senescence ocu04310   Wnt signaling pathway ocu04722   Neurotrophin signaling pathway ocu04919   Thyroid hormone signaling pathway ocu05012   Parkinson disease ocu05014   Amyotrophic lateral sclerosis ocu05016   Huntington disease ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05165   Human papillomavirus infection ocu05166   Human T-cell leukemia virus 1 infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05200   Pathways in cancer ocu05202   Transcriptional misregulation in cancer ocu05203   Viral carcinogenesis ocu05205   Proteoglycans in cancer ocu05206   MicroRNAs in cancer ocu05210   Colorectal cancer ocu05212   Pancreatic cancer ocu05213   Endometrial cancer ocu05214   Glioma ocu05215   Prostate cancer ocu05216   Thyroid cancer ocu05217   Basal cell carcinoma ocu05218   Melanoma ocu05219   Bladder cancer ocu05220   Chronic myeloid leukemia ocu05222   Small cell lung cancer ocu05223   Non-small cell lung cancer ocu05224   Breast cancer ocu05225   Hepatocellular carcinoma ocu05226   Gastric cancer ocu05230   Central carbon metabolism in cancer ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     100009292 (TP53)    04071 Sphingolipid signaling pathway     100009292 (TP53)    04151 PI3K-Akt signaling pathway     100009292 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     100009292 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     100009292 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     100009292 (TP53)   09149 Aging    04211 Longevity regulating pathway     100009292 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100009292 (TP53)    05202 Transcriptional misregulation in cancer     100009292 (TP53)    05206 MicroRNAs in cancer     100009292 (TP53)    05205 Proteoglycans in cancer     100009292 (TP53)    05203 Viral carcinogenesis     100009292 (TP53)    05230 Central carbon metabolism in cancer     100009292 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     100009292 (TP53)    05212 Pancreatic cancer     100009292 (TP53)    05225 Hepatocellular carcinoma     100009292 (TP53)    05226 Gastric cancer     100009292 (TP53)    05214 Glioma     100009292 (TP53)    05216 Thyroid cancer     100009292 (TP53)    05220 Chronic myeloid leukemia     100009292 (TP53)    05217 Basal cell carcinoma     100009292 (TP53)    05218 Melanoma     100009292 (TP53)    05219 Bladder cancer     100009292 (TP53)    05215 Prostate cancer     100009292 (TP53)    05213 Endometrial cancer     100009292 (TP53)    05224 Breast cancer     100009292 (TP53)    05222 Small cell lung cancer     100009292 (TP53)    05223 Non-small cell lung cancer     100009292 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100009292 (TP53)    05161 Hepatitis B     100009292 (TP53)    05160 Hepatitis C     100009292 (TP53)    05162 Measles     100009292 (TP53)    05163 Human cytomegalovirus infection     100009292 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     100009292 (TP53)    05169 Epstein-Barr virus infection     100009292 (TP53)    05165 Human papillomavirus infection     100009292 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     100009292 (TP53)    05014 Amyotrophic lateral sclerosis     100009292 (TP53)    05016 Huntington disease     100009292 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100009292 (TP53)    05418 Fluid shear stress and atherosclerosis     100009292 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100009292 (TP53)    01522 Endocrine resistance     100009292 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ocu03000]     100009292 (TP53)    03036 Chromosome and associated proteins [BR:ocu03036]     100009292 (TP53)    03400 DNA repair and recombination proteins [BR:ocu03400]     100009292 (TP53) Transcription factors [BR:ocu03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     100009292 (TP53) Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      100009292 (TP53) DNA repair and recombination proteins [BR:ocu03400]  Eukaryotic type   Check point factors    Other check point factors     100009292 (TP53) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  P53 P53_tetramer P53_TAD DEC-1_N Motif Other DBs NCBI-GeneID:  100009292 NCBI-ProteinID:  NP_001075873 Ensembl:  ENSOCUG00000001138 UniProt:  Q95330 LinkDB All DBs Position 19:9141511..9152947 Genome browser AA seq 391 aa AA seqDB search MEESQSDLSLEPPLSQETFSDLWKLLPENNLLTTSLNPPVDDLLSAEDVANWLNEDPEEG LRVPAAPAPEAPAPAAPALAAPAPATSWPLSSSVPSQKTYHGNYGFRLGFLHSGTAKSVT CTYSPCLNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERCS DSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCM GGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPCPELPPGS SKRALPTTTTDSSPQTKKKPLDGEYFILKIRGRERFEMFRELNEALELKDAQAEKEPGGS RAHSSYLKAKKGQSTSRHKKPMFKREGPDSD NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt atggaggagtcgcagtcggatctcagcctcgagcctcccctgagtcaggagacgttttca gacctgtggaaactgcttcctgagaacaacctgctgaccacctcgctgaaccctcccgtg gatgatctgctgtctgcagaagacgttgcaaactggctcaacgaagacccagaagaaggg ctccgagtaccagcagctcctgcaccagaggcccccgccccagctgcccctgcgctggcg gcccctgcaccagccacctcctggcccctgtcatcctctgtcccttcccaaaagacctac catggcaactacggtttccggctgggcttcctgcactctgggacggccaagtctgtcacc tgcacatactccccctgcctcaacaagctgttctgccagctagcaaagacctgccctgtg cagctgtgggtcgactcgacgcccccgcctggcacccgcgtccgggccatggccatctac aagaagtctcagcacatgacggaagttgtcagacgctgcccccaccacgagcgctgctcc gacagcgatggtctggccccccctcagcatctcatccgggtggagggaaatctccgtgcg gagtatttggatgacagaaacaccttccgacacagcgtggtggtgccctacgagccgccc gaggttggctctgactgtaccaccatccactataattacatgtgtaacagctcctgcatg gggggcatgaaccggcggcccatcctcaccatcatcacactggaagactccagtgggaac ctgctgggacggaacagctttgaggtgcgagtgtgtgcctgtcctgggagggaccgccgc acggaggaagaaaatttccgcaagaaaggggagccctgccctgaactgccccctgggagc tctaagcgagcactgccgaccaccaccaccgactcctctccccagacaaagaagaagccg ctggatggagaatatttcatccttaagatccgcgggcgtgaacggttcgagatgttccga gagctgaacgaggccctggagctaaaggatgcccaggccgagaaggagcccggggggagc agggctcactccagctacctgaaggccaagaaggggcagtctacctcccgccataaaaaa ccaatgttcaagagagaggggcctgactcagactga

DBGET integrated database retrieval system