KEGG   Oryctolagus cuniculus (rabbit): 100009325
Entry
100009325         CDS       T03373                                 
Symbol
GHR
Name
(RefSeq) growth hormone receptor
  KO
K05080  growth hormone receptor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04080  Neuroactive ligand-receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100009325 (GHR)
   04151 PI3K-Akt signaling pathway
    100009325 (GHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100009325 (GHR)
   04060 Cytokine-cytokine receptor interaction
    100009325 (GHR)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100009325 (GHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100009325 (GHR)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  Prolactin receptor family
   100009325 (GHR)
SSDB
Motif
Pfam: GHBP EpoR_lig-bind fn3 DUF4605
Other DBs
NCBI-GeneID: 100009325
NCBI-ProteinID: NP_001076105
Ensembl: ENSOCUG00000008496
UniProt: P19941
LinkDB
Position
11:63241661..63539295
AA seq 638 aa
MDLWQLLLTVALAGSSDAFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPE
LETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTS
IWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPN
ADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKY
GEFSEVLYVTLPQMSPFTCEEDFRFPWFLIIIFGIFGLTVMLFVFIFSKQQRIKMLILPP
VPVPKIKGIDPDLLKEGKLEEVNTILAIQDSYKPEFYNDDSWVEFIELDIDDPDEKTEGS
DTDRLLSNSHQKSLSVLAAKDDDSGRTSCYEPDILENDFNASDGCDGNSEVAQPQRLKGE
ADLLCLDQKNQNNSPYHDVSPAAQQPEVVLAEEDKPRPLLTGEIESTLQAAPSQLSNPNS
LANIDFYAQVSDITPAGSVVLSPGQKNKAGNSQCDAHPEVVSLCQTNFIMDNAYFCEADA
KKCIAVAPHVDVESRVEPSFNQEDIYITTESLTTTAERSGTAEDAPGSEMPVPDYTSIHL
VQSPQGLVLNAATLPLPDKEFLSSCGYVSTDQLNKILP
NT seq 1917 nt   +upstreamnt  +downstreamnt
atggatctctggcagctgctgttgaccgtggcactagcagggtcaagtgatgctttttct
gggagtgaggccacaccagctacccttggcagagcatccgagagtgtgcaaagagttcat
ccaggcctggggacaaattcttctgggaagcccaaattcaccaagtgccgttcacctgaa
ctagagactttttcatgccactggacagatggggttcatcatggtttaaagagcccagga
tctgtgcagctgttctatattaggaggaacactcaagaatggactcaagaatggaaagaa
tgccctgactatgtttctgctggggagaacagctgttactttaattcatcctatacctcc
atttggatcccctactgtatcaagctaactaacaatggtggtatggtggatcaaaagtgt
ttctctgttgaggaaatagtgcaaccagatccacccattggcctcaactggactttactg
aatgttagcttaaccgggattcatgcagatattcaagtgcgatgggaaccaccacccaat
gcagatgttcagaagggatggatagtcttggagtatgaacttcaatacaaagaagtcaat
gaaactcaatggaaaatgatggaccctgtattgtcgacatcagttcctgtgtactcgtta
agactggacaaagaatatgaagtgcgtgtgagatccagacagcgaagctctgaaaaatat
ggcgagttcagtgaggtgctctatgtaacccttcctcaaatgagcccattcacatgtgaa
gaagatttccggtttccatggttcttaattattatctttggaatatttggactaacagtg
atgctattcgtattcatattttctaaacagcaaaggattaagatgctgattctgccccca
gttccagttccaaagattaaaggaatcgatccagatctcctcaaggaaggaaagttagag
gaggtgaacacaatcttagccattcaagatagctataagcctgaattctacaatgatgac
tcttgggttgaattcatcgagctagacatcgatgaccctgatgaaaagactgagggatca
gacacagaccgacttctaagcaacagccatcagaaatcacttagcgtccttgcagcaaag
gatgacgactctggacgaaccagctgttacgaacctgacatcctggagaatgatttcaat
gccagtgacgggtgcgacgggaactcggaggttgctcagcctcaaaggttaaaaggggaa
gcagatctcttgtgccttgaccagaagaatcaaaataactcaccttaccatgatgtttct
cctgctgctcagcagcctgaggtcgtcctagcagaggaagacaaaccgcgaccacttctt
actggtgagattgaatccactcttcaggctgcaccttctcagctcagcaatccaaattca
ctggcaaacatcgacttttacgcccaggttagtgacattacgccggcagggagtgtggtc
ctttccccaggccagaagaacaaggcagggaattctcagtgtgatgcgcatccagaagtc
gtctcactctgccagacaaacttcatcatggacaacgcctacttctgtgaagcagatgcc
aaaaagtgtatcgctgtggcccctcatgtcgacgtcgaatcacgtgtcgagccaagcttt
aaccaggaggacatttacatcaccacagaaagccttaccactactgccgagaggtctggg
acagcagaagacgccccaggttctgagatgcctgtcccagactatacctccattcattta
gtacaatctccacaaggccttgtactcaatgcagccaccttgcccttgcctgacaaagag
tttctctcatcgtgtggctacgtgagcacagaccaactgaacaaaatcttgccatag

DBGET integrated database retrieval system