KEGG   Oryctolagus cuniculus (rabbit): 100009578
Entry
100009578         CDS       T03373                                 
Symbol
TLR2
Name
(RefSeq) toll like receptor 2
  KO
K10159  toll-like receptor 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04151  PI3K-Akt signaling pathway
ocu04613  Neutrophil extracellular trap formation
ocu04620  Toll-like receptor signaling pathway
ocu05132  Salmonella infection
ocu05134  Legionellosis
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05162  Measles
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05205  Proteoglycans in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100009578 (TLR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100009578 (TLR2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100009578 (TLR2)
   04620 Toll-like receptor signaling pathway
    100009578 (TLR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100009578 (TLR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100009578 (TLR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100009578 (TLR2)
   05161 Hepatitis B
    100009578 (TLR2)
   05171 Coronavirus disease - COVID-19
    100009578 (TLR2)
   05162 Measles
    100009578 (TLR2)
   05168 Herpes simplex virus 1 infection
    100009578 (TLR2)
   05169 Epstein-Barr virus infection
    100009578 (TLR2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100009578 (TLR2)
   05134 Legionellosis
    100009578 (TLR2)
   05152 Tuberculosis
    100009578 (TLR2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100009578 (TLR2)
   05144 Malaria
    100009578 (TLR2)
   05145 Toxoplasmosis
    100009578 (TLR2)
   05140 Leishmaniasis
    100009578 (TLR2)
   05142 Chagas disease
    100009578 (TLR2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100009578 (TLR2)
   05321 Inflammatory bowel disease
    100009578 (TLR2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100009578 (TLR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100009578 (TLR2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100009578 (TLR2)
   04054 Pattern recognition receptors [BR:ocu04054]
    100009578 (TLR2)
   04090 CD molecules [BR:ocu04090]
    100009578 (TLR2)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100009578 (TLR2)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    100009578 (TLR2)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   100009578 (TLR2)
Pattern recognition receptors [BR:ocu04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   100009578 (TLR2)
CD molecules [BR:ocu04090]
 Proteins
  100009578 (TLR2)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Hyaluronan
  Cell surface receptors
   100009578 (TLR2)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_9 LRR_5 LRR_1 LRRCT
Other DBs
NCBI-GeneID: 100009578
NCBI-ProteinID: NP_001076250
Ensembl: ENSOCUG00000003367
UniProt: Q8MIQ3
LinkDB
Position
15:9907319..9921223
AA seq 784 aa
MPPALWTVWALGAIVSLPTEGAPDLPSLSCDPAGICDGRSRSFQSIPSGLMATVKSLDLS
NNEITYIRDSDLHRCVHLRALMLMSNGIDTIDEDSFSSLGSLEHLDLSNNHLSHLSAAWF
RPLSSLKFLNLLENPYRTLGETSLFSHLPHLRILKVGSLYAFANIRRMDFAGVRSLEELE
IDGSNLQSYEPRGLGSIPNVSRLVLHLRQPTLLLKLFPDLLSSVECLELRETDLEDFRFS
GLSVTEPNPRITRFIFRSVKITDESCNEILKLLAYVPELLDLEFDDCTLNGVGDFEVPDR
DLSQDLGKVETLTIRRLHIPKFYLFYDLSTIYSLSERVKRVTVENSKVFLVPCSFSQHLK
SLEYLDLSENLMVEEYLKNSACEKAWPSLQTLILRQNHLTSLEKTGETLLTLKNLTDLDI
SKNTFHAMPDTCQWPERLRRLNLSSTRIHSLTYCIPQTLEILDVSNNNLNVFSLTLPRLK
ELYISRNMLKTLPGASLLPMLLVMKISRNSINTFSKEQLESFQKVTALEAGGNNFICSCD
FLSLTQEQPALTRVLPDWPESYLCDSPSHVRGQQVQDARLSVSECHRAAVVSGVCCALLL
LTLLAVVLCRHFHGLWYLKMTWAWLQAKRKPRKAACRDVCYDAFVSYSEHDSYWVENLLV
QELENSDPPFRLCLHKRDFVPGKWIIDNIIDCIEKSRKTVFVLSQNFVKSEWCKYELDFS
HFRLFDENNDAAILVLLEPIEKKAIPQRFCKLRKIMNTRTYLEWPTEEAEHAGFWGNLRA
AIKS
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgccacctgcgttgtggacggtgtgggccttgggggctatagtcagcctccccacggaa
ggggctcctgacctgccctctctgtcttgtgaccctgccggcatctgcgatgggcgctcc
agatccttccaatccatcccctcggggctcatggcaacggtgaaaagccttgacctgtcc
aacaacgagatcacctatatcagagacagtgacttgcacaggtgtgtgcacctcagggct
ctgatgctgatgtccaatggaatcgacacgatagatgaagattctttctcttccctgggc
agcctcgagcacctggacttatccaataaccacctatctcatttatccgccgcctggttc
aggcctctctcgtccctgaaattcttaaacttgctggaaaacccttacagaacccttggg
gagacatctctgttttctcacctcccacatttgcgaatcctgaaagtaggaagcctttat
gcctttgcgaatattcggaggatggattttgccggagtccgctctctcgaggaacttgag
attgatgggtcaaacctgcagagctacgagccacggggcttgggatccatccccaacgtg
agccgcctggttctccacctgaggcagcccaccttgctgctcaagctcttcccagacctt
ttaagttctgtggagtgtctggagctgagagagactgatctggaagatttccgtttttcg
gggctgtctgtcaccgaaccgaatccacggattaccagatttatctttagaagtgtgaaa
atcaccgatgagagttgtaatgaaatactcaaacttctggcttatgtgcctgagttactg
gacttagagtttgatgactgcacccttaatggagttggtgattttgaagtaccagaccga
gacctaagtcaagatctgggtaaagtcgaaacgttaacaatacggaggttgcacatcccc
aagttctacttattttacgatctgagtacaatctattcactctcagaaagggtgaagagg
gtcacagtggaaaacagtaaggtttttttggttccttgttcattctcacaacatttaaaa
tcattagaatacttagatctcagtgaaaatctgatggtggaagaatatttgaaaaattca
gcctgcgagaaggcctggccctctctgcagacgttaattttaaggcaaaatcatttgaca
tcattagaaaaaaccggagagaccctgctgacgctgaaaaacctgaccgaccttgacatc
agtaagaatactttccacgccatgcctgacacgtgtcagtggccggaaaggttgagacgg
ctgaacctgtccagcacacggatacacagtttgacgtactgcatcccacagaccctggaa
atcctagacgttagcaataacaatctcaacgtgttttctttgactctgcccagactcaaa
gaactttatatttccagaaatatgttaaagaccctcccaggtgcctccttgttacctatg
ctactggtcatgaaaatcagcaggaattcgataaacactttttcgaaggagcagctcgaa
tcctttcagaaggtgacggccttggaagccggagggaacaacttcatctgctcctgcgac
ttcctgtctttgactcaggagcagcccgcgctgaccagggtcctgccggactggccagag
agctacctgtgtgactccccatcccatgtgcgtggccagcaggtgcaggacgcgcgcctg
tcggtgtccgagtgccacagggcagcggtggtgtctggcgtgtgctgtgccctcctcctg
ctgacgctgctcgccgtggtcctgtgccgccatttccacgggctgtggtacctgaagatg
acgtgggcctggctgcaggccaagaggaagccgaggaaagcggcctgcagggacgtgtgt
tacgatgcgttcgtgtcctacagcgagcacgactcctactgggtggagaacctgctggtg
caggagctggagaactccgaccccccgttcaggctgtgtctgcacaagcgggactttgtg
cccggcaagtggatcattgacaacatcatcgactgcatcgagaagagccgcaagaccgtc
ttcgtgctctcgcagaacttcgtcaagagcgagtggtgcaagtacgagctggacttctcc
cacttccgcctctttgatgagaacaacgacgccgccattctggtgctcctggagcccatt
gagaaaaaggccatcccccagcgcttctgcaagctgcgcaagatcatgaacaccaggacc
tacctggagtggcccacggaggaggctgagcacgccgggttctgggggaacttgagggcc
gccataaagtcctag

DBGET integrated database retrieval system