KEGG   Oryctolagus cuniculus (rabbit): 100101580
Entry
100101580         CDS       T03373                                 
Symbol
CASP10
Name
(RefSeq) caspase 10
  KO
K04400  caspase 10 [EC:3.4.22.63]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04210  Apoptosis
ocu04622  RIG-I-like receptor signaling pathway
ocu04668  TNF signaling pathway
ocu05152  Tuberculosis
ocu05161  Hepatitis B
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100101580 (CASP10)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100101580 (CASP10)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100101580 (CASP10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100101580 (CASP10)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100101580 (CASP10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100101580 (CASP10)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.63  caspase-10
     100101580 (CASP10)
Peptidases and inhibitors [BR:ocu01002]
 Cysteine peptidases
  Family C14: caspase family
   100101580 (CASP10)
SSDB
Motif
Pfam: Peptidase_C14 DED RhoGAP RD3 COX2_TM YqfQ GAT
Other DBs
NCBI-GeneID: 100101580
NCBI-ProteinID: NP_001093436
Ensembl: ENSOCUG00000004510
UniProt: A5HAU9
LinkDB
Position
7:141928484..141969186
AA seq 469 aa
MASGDQSLGSSSDEENFRRILFTIDSHLGGQEVESLKFLCLDLVSKKKLEKCSSALDIFE
LLLTYKLLQEEDPFVLAELLYITKQIKLLQHLRYTKEEVERLLPERRKVPLFRKMLYELA
EAIDTDTLKSMTFLLRDSMPRTEMNSLHLLEHLEKRDDIHEDNLTYLEDLCKKVAPSLMR
IIEKYKNEKDKQTESLHEGEEELVSQSDIKRFVGALQEANVYRMDRKHRGRCVIVNNEIF
TTYLSDRRGTQRDAEYLKLVFQWLGFKVHKCDNKTKEDLEALLQEEKHHPDHDDGDCFVF
CVLTHGIFGAVYSSDGVLIPIREIVSHFTAKQCPGLAGKPKLFFIQACQGKEIQSSAPIE
ADAVNPECVPPSLQDSIPVEADFLLGLATVPGYASLRHVENGSWYIQSLCNHLKALVPRH
EDILSILTAVNNDVSRQADKSGRMRQMPQPAFTLRKRLVFPVPQEEPSF
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggcatctggagatcaaagcttgggttccagttcagatgaggaaaactttcgtaggata
cttttcacgatcgattcgcacctggggggccaggaagtggagagcctgaagtttctttgc
ctggacttggtctccaaaaagaagctggagaagtgtagctccgccttggatatttttgaa
ctcctcttgacgtacaagctgctgcaagaagaggaccctttcgtcctggcagaactcctc
tacatcacgaagcagatcaaactgctgcagcacctcaggtacaccaaagaggaagtggag
cgtttgctgcccgagagaaggaaggtgcccctgttcagaaagatgctctacgaactggca
gaagccatcgacacagacaccttaaagagcatgaccttccttctgagagattctatgccc
agaaccgagatgaactcgctgcatttgctggaacatctggagaaacgtgatgatatacat
gaagacaatctgacgtacttggaggacctctgcaaaaaggtggcccctagcctgatgaga
ataatagagaagtacaaaaatgagaaagacaagcaaactgaatcattgcatgaaggagag
gaagagctggtttcacagtcagacattaaacgattcgttggagccttacaggaagccaac
gtgtacaggatggatcgcaagcacagaggccgctgtgtcattgtcaacaacgaaatattt
accacctatctgtcagacagacgagggacccagagggacgcggagtacctgaagctcgtg
ttccagtggctcgggttcaaagtacacaagtgtgataataagactaaggaagacctggag
gcgctgttgcaggaggagaaacatcacccagaccatgatgatggggactgcttcgtgttc
tgtgttctgactcatggcatatttggagctgtctactcttcagacggggtcctcatcccc
attcgggagattgtatcccacttcacagccaagcaatgccctggattggctggcaaacct
aaactctttttcatccaggcctgtcaagggaaagagatacaatcttctgcgcccatagaa
gcagatgctgtgaatcctgagtgtgtacctccttcccttcaggacagtatccctgtcgag
gctgatttcctgcttggtctggctactgttccaggttatgcctcccttcggcatgtggag
aatggcagctggtacatccagtctctgtgtaatcatctgaaagccttggtcccaaggcat
gaagacatcctgtccatcctcactgctgttaacaatgatgtgagccgacaagcagacaaa
agcggaagaatgagacagatgccgcagcctgctttcactctaaggaagagactagtattc
cctgtgccacaggaagagccttcattctag

DBGET integrated database retrieval system