KEGG   Oryctolagus cuniculus (rabbit): 100101588
Entry
100101588         CDS       T03373                                 
Symbol
CASP1
Name
(RefSeq) caspase 1
  KO
K01370  caspase 1 [EC:3.4.22.36]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04217  Necroptosis
ocu04613  Neutrophil extracellular trap formation
ocu04621  NOD-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04625  C-type lectin receptor signaling pathway
ocu05014  Amyotrophic lateral sclerosis
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05134  Legionellosis
ocu05135  Yersinia infection
ocu05164  Influenza A
ocu05171  Coronavirus disease - COVID-19
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100101588 (CASP1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100101588 (CASP1)
   04621 NOD-like receptor signaling pathway
    100101588 (CASP1)
   04623 Cytosolic DNA-sensing pathway
    100101588 (CASP1)
   04625 C-type lectin receptor signaling pathway
    100101588 (CASP1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100101588 (CASP1)
   05164 Influenza A
    100101588 (CASP1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100101588 (CASP1)
   05135 Yersinia infection
    100101588 (CASP1)
   05133 Pertussis
    100101588 (CASP1)
   05134 Legionellosis
    100101588 (CASP1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100101588 (CASP1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100101588 (CASP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100101588 (CASP1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100101588 (CASP1)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.36  caspase-1
     100101588 (CASP1)
Peptidases and inhibitors [BR:ocu01002]
 Cysteine peptidases
  Family C14: caspase family
   100101588 (CASP1)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    100101588 (CASP1)
SSDB
Motif
Pfam: Peptidase_C14 CARD
Other DBs
NCBI-GeneID: 100101588
NCBI-ProteinID: XP_008260265
Ensembl: ENSOCUG00000001103
UniProt: A0A5F9DPF5
LinkDB
Position
1:111572412..111585244
AA seq 403 aa
MADRILKDRRKRFINSVGTGTINGLLDELLEKRVLNQEEMEKVRVENATVMDKARALLDC
VIRKGPQACQICINHICEDDCHLAGLLGLSSGPQSENHFNAQDSLEAFSSFSAPQTTQDN
QVVFTFSGPSLKLCPLETAQRIWKEKSEEIYPIKMQSSGRTRLALIICNTEFDSLPRRTG
ADVDIRDMKMLLIGLGYSVDVKENLNALDMATELKAFADRPEHWTSDSTFLVFMSHGTRD
GICGKNYSEQYSDILNVNTIFEMLNTKNCQSLKDKPKVIIIQACRGENQGIVWLKDSIGD
SGNTSLLNPDDFEYDASRIAHIEKDFIAFCSSTPDNVSWRHPKQGSLFIMRLIKTMQEYA
WSCDVEEIFRKVRFSFELPEGRTQMPTTERVTLTRRFYLFPGH
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggctgacaggattctaaaggacaggaggaagcggtttatcaactcggtgggcacaggt
acaataaatggcttactggatgaattgttggagaaaagagtgctgaaccaggaagagatg
gagaaagtaagagttgaaaatgctacagttatggataaggcccgggctttgctggactgt
gtcattcggaaagggccccaggcatgccagatttgcatcaaccacatttgtgaagatgac
tgtcaccttgcaggactgctggggctctcctcaggtccacaatctgaaaaccattttaat
gcacaagattctctggaagcattttcttccttttcagctccacagactacgcaggacaac
caagttgtgttcacgttctcaggtccaagtctcaagctttgcccgctagagacagcccaa
aggatatggaaagaaaagtcagaagagatttatccaataaaaatgcaaagttcaggccgc
acccgtcttgccctcattatctgcaacacagagtttgacagtctccccagaaggactgga
gctgatgttgatatcagagatatgaagatgctgctgataggtctgggatacagtgtagat
gtgaaagaaaacctcaatgctttggacatggctacagagctgaaggcctttgctgatcgc
ccagagcactggacttctgacagtactttcctagtgttcatgtctcatggtactagagat
ggtatttgtgggaagaattactctgagcaatactcagatatactgaatgtcaacaccatc
tttgagatgttaaacaccaagaactgtcagagtttgaaagacaaacccaaggtgatcatc
atccaagcctgtcgtggtgaaaaccaaggaatagtgtggctaaaggattcaataggagat
tctggaaacacatctttactgaatccagatgattttgagtatgatgctagtaggatagcc
cacatagagaaggattttattgctttctgctcttcaactccagataatgtttcttggcga
catcccaaacagggttcacttttcattatgagactcatcaaaactatgcaggaatatgcc
tggtcttgtgatgtggaggaaatcttccgaaaggttcgattttcatttgaactgccagaa
ggtaggacacagatgcctaccactgaaagggtgacattgacaagacgtttctatctcttc
ccaggacattaa

DBGET integrated database retrieval system