KEGG   Oryctolagus cuniculus (rabbit): 100144338
Entry
100144338         CDS       T03373                                 
Symbol
IL18
Name
(RefSeq) interleukin 18
  KO
K05482  interleukin 18
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04621  NOD-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu05132  Salmonella infection
ocu05134  Legionellosis
ocu05135  Yersinia infection
ocu05143  African trypanosomiasis
ocu05144  Malaria
ocu05152  Tuberculosis
ocu05164  Influenza A
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100144338 (IL18)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100144338 (IL18)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100144338 (IL18)
   04623 Cytosolic DNA-sensing pathway
    100144338 (IL18)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100144338 (IL18)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100144338 (IL18)
   05135 Yersinia infection
    100144338 (IL18)
   05134 Legionellosis
    100144338 (IL18)
   05152 Tuberculosis
    100144338 (IL18)
  09174 Infectious disease: parasitic
   05144 Malaria
    100144338 (IL18)
   05143 African trypanosomiasis
    100144338 (IL18)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100144338 (IL18)
   05321 Inflammatory bowel disease
    100144338 (IL18)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100144338 (IL18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100144338 (IL18)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100144338 (IL18)
SSDB
Motif
Pfam: IL1
Other DBs
NCBI-GeneID: 100144338
NCBI-ProteinID: NP_001116412
UniProt: B1A3U4
LinkDB
Position
1:104215287..104234949
AA seq 192 aa
MAAEPEEACINFVGMKFIDNTLYFITENDENLESDYFGKLEPKISIIRNLNDQVLFMDQG
QQPVFEDMPDSDCIENAPQTIFIIYMYKDSNTRGMAVSLSVKCKKIFTLSCENKIISFKE
LTPPNDINDTKSDIIFFQKHLAGQKDKMQFESSLYDGYFLACGKEKDLFKLVLKRKDDKN
DKSVIFSVQNKN
NT seq 579 nt   +upstreamnt  +downstreamnt
atggctgctgaaccagaagaggcttgcatcaactttgtgggaatgaaatttattgacaac
acactttactttataactgaaaacgatgagaacctggaatcagattactttggcaagctt
gaaccgaaaatctccatcatacgaaacctgaatgaccaagttctcttcatggaccaagga
cagcaacctgtgtttgaggatatgcccgattctgactgtatagaaaatgcaccccagacc
atttttataatatatatgtataaagacagcaatactagaggcatggctgtaagcctctct
gtgaagtgtaagaaaatttttacactctcctgtgagaacaaaattatttcctttaaggaa
ctcactcctcctaatgacatcaacgatacaaaaagtgacatcatattctttcagaaacat
ctcgcaggacagaaagataagatgcagtttgagtcttcattgtatgacggatactttcta
gcttgtggaaaggagaaagatcttttcaaacttgttttgaaacgtaaagatgacaaaaac
gataaatctgtaattttcagtgtccaaaacaagaattag

DBGET integrated database retrieval system