Oryctolagus cuniculus (rabbit): 100328583 Help Entry 100328583         CDS       T03373                                  Symbol GRO-B Name (RefSeq) permeability factor 2   KO K05505   C-X-C motif chemokine 1/2/3 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04061   Viral protein interaction with cytokine and cytokine receptor ocu04062   Chemokine signaling pathway ocu04064   NF-kappa B signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04657   IL-17 signaling pathway ocu04668   TNF signaling pathway ocu04936   Alcoholic liver disease ocu05134   Legionellosis ocu05146   Amoebiasis ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05323   Rheumatoid arthritis ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100328583 (GRO-B)    04668 TNF signaling pathway     100328583 (GRO-B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100328583 (GRO-B)    04061 Viral protein interaction with cytokine and cytokine receptor     100328583 (GRO-B)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100328583 (GRO-B)    04657 IL-17 signaling pathway     100328583 (GRO-B)    04062 Chemokine signaling pathway     100328583 (GRO-B)  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     100328583 (GRO-B)   09171 Infectious disease: bacterial    05134 Legionellosis     100328583 (GRO-B)   09174 Infectious disease: parasitic    05146 Amoebiasis     100328583 (GRO-B)   09163 Immune disease    05323 Rheumatoid arthritis     100328583 (GRO-B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100328583 (GRO-B)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100328583 (GRO-B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100328583 (GRO-B) Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Chemokines    100328583 (GRO-B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100328583 NCBI-ProteinID:  XP_002717067 LinkDB All DBs Position 15:complement(73157619..73159949) Genome browser AA seq 190 aa AA seqDB search MLGPHPGVPHSYAGGRGRCHSSVTRDPPGASGIPRAPGLPLFPPRMGIKGVLRSQRATEP GRPHQPQLPRSRSPRRRHLPPSPMAPAACPAAPSAPRLLRTALLLLLLLAASRRAAGAPA LTELRCQCLQTVQGIHLKNIQNLKVLSPGPHCAQTEVIATLKSGQEACLNPAAPMVKKFL QKRLSNGNSS NT seq 573 nt NT seq  +upstreamnt  +downstreamnt atgcttggcccccaccccggggtcccgcacagttacgcaggagggcggggccggtgtcat tcttccgtgaccagagatccaccaggagcttcgggaattccccgggccccggggctccca cttttcccgccccgaatgggcataaaaggggttctccgatcgcagcgagccacagagccc ggacggccacaccagccacagctgcctcgctccagatccccccgccgccgccacctgccg ccgagtcccatggcccccgccgcgtgccccgccgcgcccagcgctccccggctcctgcgg accgcgctgctgctgctgctgctgctggccgccagcaggcgagcagcaggggcgcccgcg ctcaccgagctgcgctgccagtgtctgcagaccgtgcagggcattcacctcaagaacatc cagaacctgaaggtgctgtcgccgggcccgcactgcgcccagaccgaagtcatagccacg ctcaagtccgggcaggaagcttgtctcaaccccgccgcccccatggtgaagaaattcctg cagaagaggctcagcaatggcaactccagctga

DBGET integrated database retrieval system