KEGG   Oryctolagus cuniculus (rabbit): 100328622
Entry
100328622         CDS       T03373                                 
Symbol
CXCR1, IL8RA
Name
(RefSeq) C-X-C motif chemokine receptor 1
  KO
K04175  C-X-C chemokine receptor type 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100328622 (CXCR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100328622 (CXCR1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100328622 (CXCR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100328622 (CXCR1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100328622 (CXCR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100328622 (CXCR1)
   04050 Cytokine receptors [BR:ocu04050]
    100328622 (CXCR1)
   04090 CD molecules [BR:ocu04090]
    100328622 (CXCR1)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    100328622 (CXCR1)
Cytokine receptors [BR:ocu04050]
 Chemokine receptors
  CXC Chemokine
   100328622 (CXCR1)
CD molecules [BR:ocu04090]
 Proteins
  100328622 (CXCR1)
SSDB
Motif
Pfam: 7tm_1 TMEM70
Other DBs
NCBI-GeneID: 100328622
NCBI-ProteinID: NP_001164553
UniProt: P21109
LinkDB
Position
7:complement(159538471..159542419)
AA seq 355 aa
MEVNVWNMTDLWTWFEDEFANATGMPPVEKDYSPCLVVTQTLNKYVVVVIYALVFLLSLL
GNSLVMLVILYSRSNRSVTDVYLLNLAMADLLFALTMPIWAVSKEKGWIFGTPLCKVVSL
VKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFICLGIWALSLILSLPFFLFR
QVFSPNNSSPVCYEDLGHNTAKWRMVLRILPHTFGFILPLLVMLFCYGFTLRTLFQAHMG
QKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTHVIQETCQRRNDIDRALDATEILGF
LHSCLNPIIYAFIGQNFRNGFLKMLAARGLISKEFLTRHRVTSYTSSSTNVPSNL
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggaagtaaacgtatggaatatgactgatctgtggacgtggtttgaggatgagtttgca
aatgctactggtatgcctcctgtagaaaaagattatagcccctgtctggtagtcacccag
acacttaacaaatatgttgtggtcgtcatctatgccctggtcttcctgctgagcctgctg
ggcaactccctggtgatgctggtcatactgtacagccggagcaaccgttcggtcaccgac
gtctacctgctgaacctggccatggccgacctgctttttgccctgaccatgcctatctgg
gccgtctccaaggaaaaaggctggattttcggcacgcccctgtgcaaggtggtctcgctt
gtgaaggaagtcaacttctacagtggaatcctgctcctggcctgcatcagtgtggaccgc
tacctggccattgtccatgctactcgcacactgacccagaagcgccacttggtcaagttc
atatgtctgggcatctgggcgctgtctctgattttgtccctgcccttcttcctcttccgc
caagtcttttctccaaacaattccagcccggtctgctatgaggacctgggtcacaacaca
gcgaaatggcgcatggtgctgcggatcctgccacacactttcggcttcatcctgccgctg
ctggtcatgctgttttgctatgggttcaccctgcgcacgctgttccaggcccacatgggg
cagaagcaccgggccatgcgggtcatcttcgccgtcgtgctcatcttccttctctgctgg
ctgccctacaacctggtcctgctcgcagacaccctcatgaggacccacgtgatccaggag
acgtgtcagcgtcgcaatgacattgaccgggccctggacgccaccgagattctgggcttc
ctgcacagctgcctcaaccccatcatctacgccttcattggccaaaactttcgcaatgga
ttcctcaagatgcttgcggcccgcggccttattagcaaggagttcctgacacgacatcgg
gtcacctcttatacttcttcctctaccaacgtgccttcaaatctctaa

DBGET integrated database retrieval system