KEGG   Oryctolagus cuniculus (rabbit): 100328627
Entry
100328627         CDS       T03373                                 
Symbol
CXCR2, IL8RB
Name
(RefSeq) C-X-C motif chemokine receptor 2
  KO
K05050  C-X-C chemokine receptor type 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04144  Endocytosis
ocu05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100328627 (CXCR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100328627 (CXCR2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100328627 (CXCR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100328627 (CXCR2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100328627 (CXCR2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100328627 (CXCR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100328627 (CXCR2)
   04050 Cytokine receptors [BR:ocu04050]
    100328627 (CXCR2)
   04090 CD molecules [BR:ocu04090]
    100328627 (CXCR2)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    100328627 (CXCR2)
Cytokine receptors [BR:ocu04050]
 Chemokine receptors
  CXC Chemokine
   100328627 (CXCR2)
CD molecules [BR:ocu04090]
 Proteins
  100328627 (CXCR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 100328627
NCBI-ProteinID: NP_001164561
UniProt: P35344
LinkDB
Position
7:159494015..159501196
AA seq 358 aa
MQEFTWENYSYEDFFGDFSNYSYSTDLPPTLLDSAPCRSESLETNSYVVLITYILVFLLS
LLGNSLVMLVILYSRSTCSVTDVYLLNLAIADLLFATTLPIWAASKVHGWTFGTPLCKVV
SLVKEVNFYSGILLLACISVDRYLAIVHATRTMIQKRHLVKFICLSMWGVSLILSLPILL
FRNAIFPPNSSPVCYEDMGNSTAKWRMVLRILPQTFGFILPLLVMLFCYVFTLRTLFQAH
MGQKHRAMRVIFAVVLIFLLCWLPYNLVLLTDTLMRTHVIQETCERRNDIDRALDATEIL
GFLHSCLNPIIYAFIGQKFRYGLLKILAAHGLISKEFLAKESRPSFVASSSGNTSTTL
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgcaagagtttacctgggagaattacagctatgaagattttttcggcgatttcagcaat
tacagttacagcactgacctaccccctaccctgctagactctgctccgtgccggtcagaa
tctctggaaaccaacagctatgttgtgctcatcacctatatcctggtcttcctgctgagc
ctgctgggcaactccctggtgatgctggtcatcctgtacagccggagcacctgctcggtc
accgacgtctacctgctgaacctggccatcgccgacctgctctttgccaccaccttgccc
atctgggccgcctccaaggtgcacggctggactttcggcacgcccctgtgtaaggtggtc
tcgcttgtgaaggaagtcaacttctacagcggaatcctgctcctggcctgcatcagtgtg
gaccgctacctggccatcgtccatgccacacgcacgatgatccagaagcgccacttggtc
aagttcatatgcttaagcatgtggggagtgtctttgatcctgtctctgcccatcttactg
ttccgtaatgccatcttcccacccaattccagcccggtctgctatgaggacatggggaac
agcactgcgaaatggcgcatggtgctgcggatcctgcctcagactttcggcttcatcctg
ccgctgctggtcatgctgttttgctatgtgttcaccctgcgcacgctgttccaggcccac
atggggcagaagcaccgggccatgcgggtcatcttcgccgtcgtgctcatcttccttctc
tgttggctgccctacaacctggttctgctcacagacaccctcatgaggacccacgtgatc
caggagacgtgtgagcgccgcaatgacattgaccgggccctggacgccaccgagattctg
ggcttcctgcacagctgcctcaaccccatcatctacgccttcattggccaaaagtttcgc
tatggcctgctcaagatcctggcggcccacggcctgatcagcaaggagttcctggccaag
gagagcaggccttcctttgtcgcctcgtcttcagggaacacctctaccaccctctaa

DBGET integrated database retrieval system