Oryctolagus cuniculus (rabbit): 100328905 Help Entry 100328905         CDS       T03373                                  Symbol IKBKG Name (RefSeq) NF-kappa-B essential modulator   KO K07210   inhibitor of nuclear factor kappa-B kinase subunit gamma Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01523   Antifolate resistance ocu04010   MAPK signaling pathway ocu04014   Ras signaling pathway ocu04062   Chemokine signaling pathway ocu04064   NF-kappa B signaling pathway ocu04151   PI3K-Akt signaling pathway ocu04210   Apoptosis ocu04380   Osteoclast differentiation ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04623   Cytosolic DNA-sensing pathway ocu04625   C-type lectin receptor signaling pathway ocu04657   IL-17 signaling pathway ocu04658   Th1 and Th2 cell differentiation ocu04659   Th17 cell differentiation ocu04660   T cell receptor signaling pathway ocu04662   B cell receptor signaling pathway ocu04668   TNF signaling pathway ocu04920   Adipocytokine signaling pathway ocu04936   Alcoholic liver disease ocu05010   Alzheimer disease ocu05132   Salmonella infection ocu05135   Yersinia infection ocu05142   Chagas disease ocu05145   Toxoplasmosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05165   Human papillomavirus infection ocu05166   Human T-cell leukemia virus 1 infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05212   Pancreatic cancer ocu05215   Prostate cancer ocu05220   Chronic myeloid leukemia ocu05221   Acute myeloid leukemia ocu05222   Small cell lung cancer ocu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ocu05340   Primary immunodeficiency ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100328905 (IKBKG)    04064 NF-kappa B signaling pathway     100328905 (IKBKG)    04668 TNF signaling pathway     100328905 (IKBKG)    04151 PI3K-Akt signaling pathway     100328905 (IKBKG)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100328905 (IKBKG)    04660 T cell receptor signaling pathway     100328905 (IKBKG)    04658 Th1 and Th2 cell differentiation     100328905 (IKBKG)    04659 Th17 cell differentiation     100328905 (IKBKG)    04657 IL-17 signaling pathway     100328905 (IKBKG)    04662 B cell receptor signaling pathway     100328905 (IKBKG)    04062 Chemokine signaling pathway     100328905 (IKBKG)   09158 Development and regeneration    04380 Osteoclast differentiation     100328905 (IKBKG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100328905 (IKBKG)    05208 Chemical carcinogenesis - reactive oxygen species     100328905 (IKBKG)    05203 Viral carcinogenesis     100328905 (IKBKG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100328905 (IKBKG)   09162 Cancer: specific types    05212 Pancreatic cancer     100328905 (IKBKG)    05221 Acute myeloid leukemia     100328905 (IKBKG)    05220 Chronic myeloid leukemia     100328905 (IKBKG)    05215 Prostate cancer     100328905 (IKBKG)    05222 Small cell lung cancer     100328905 (IKBKG)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100328905 (IKBKG)    05170 Human immunodeficiency virus 1 infection     100328905 (IKBKG)    05161 Hepatitis B     100328905 (IKBKG)    05160 Hepatitis C     100328905 (IKBKG)    05171 Coronavirus disease - COVID-19     100328905 (IKBKG)    05164 Influenza A     100328905 (IKBKG)    05162 Measles     100328905 (IKBKG)    05163 Human cytomegalovirus infection     100328905 (IKBKG)    05167 Kaposi sarcoma-associated herpesvirus infection     100328905 (IKBKG)    05169 Epstein-Barr virus infection     100328905 (IKBKG)    05165 Human papillomavirus infection     100328905 (IKBKG)   09171 Infectious disease: bacterial    05135 Yersinia infection     100328905 (IKBKG)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100328905 (IKBKG)    05142 Chagas disease     100328905 (IKBKG)   09163 Immune disease    05340 Primary immunodeficiency     100328905 (IKBKG)   09164 Neurodegenerative disease    05010 Alzheimer disease     100328905 (IKBKG)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100328905 (IKBKG)    05418 Fluid shear stress and atherosclerosis     100328905 (IKBKG)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100328905 (IKBKG)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     100328905 (IKBKG)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     100328905 (IKBKG) Protein kinases [BR:ocu01001]  Serine/threonine kinases: Other   IKK family [OT]    100328905 (IKBKG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CC2-LZ NEMO zf_C2H2_10 Zn_SUZ12 LLC1 Nairovirus_NSm Motif Other DBs NCBI-GeneID:  100328905 NCBI-ProteinID:  NP_001164965 Ensembl:  ENSOCUG00000007873 UniProt:  B7NZR1 LinkDB All DBs AA seq 419 aa AA seqDB search MSRQPWKNQLCEMVQPSGGPAGDQDVLPEESSLGKPAMLHLPAEQGAPDALQRCLEENQE LRDAIRQSNQMLRERCEELLRFQVSQREEKEFLLCKFQEARKLVERLNLEKLDLKRQREQ ALQEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKEREALEGRARAASEQ ARQLESEREALQQQHSVQVDQLRMQSQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQD YDNHIKNSMVSGERKRGMQLEDLKQQLRQAEEALVAKQEVIDKLKEEAEQHKMVMETVPV LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDLRKRH VEVSQPPLPPAPAHHSFYLTLSNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt atgagcaggcagccctggaagaaccagctgtgtgagatggtgcagcccagcggcggcccg gccggggaccaggacgtgctgcctgaagagtcttctctggggaagccggccatgctgcat ctgcccgcagagcagggtgctcctgacgctctccagcgctgtctggaggagaaccaagag ctccgagatgccatccggcagagcaaccagatgctgcgggagcgctgtgaggagctgctg cgtttccaggtcagccagagggaggagaaggagttcctcctgtgcaagttccaggaggcc aggaaactggtggagagactgaacctggagaagctcgacctgaagaggcagagagagcag gccctgcaggaggtggagcacctgaagagatgccagcagcagatggccgaggacaaggcc tctgtgaaagctcaggtgacatccttgcttggggagctccaggagagccagagtcgcttg gaggctgccactaaggagcgagaggctttggagggcagggcccgggcagccagtgagcag gccaggcagctggagagtgagcgggaggcgctgcagcagcagcacagcgtgcaggtggac cagctgcgcatgcagagccagagcgtggaggccgccctgcgcatggagcgccaggctgcc tcagaggaaaagcggaagctggcccagttgcaggtggcatatcaccagctcttccaggac tatgacaaccacatcaagaacagcatggtgagcggtgagcggaagcgggggatgcagctg gaggatctgaagcagcagctccggcaggccgaggaggccctggtggccaagcaagaagtg attgacaagttgaaggaggaggccgagcagcacaagatggtgatggagaccgtgccagtc ctgaaggcccaggcggatatctacaaggcagacttccaggctgagaggcaggcccgggag aagctggctgaaaagaaggagctgctgcaggagcagctggagcagctgcagagggagtac agcaagctgaaggccagctgtcaggagtcagccaggattgaggatctgaggaagcggcat gtagaggtctcccagccccctctgccccctgccccagcccaccactccttctatctgacg ctgagcaaccagaggagaagccccccagaggagccgcctgacttctgttgtcctaagtgc caatatcaggctcccgatatggacaccctgcagatacacgtcatggagtgcatcgagtag

DBGET integrated database retrieval system