KEGG   Oryctolagus cuniculus (rabbit): 100337909
Entry
100337909         CDS       T03373                                 
Name
(RefSeq) low affinity immunoglobulin gamma Fc region receptor III-B
  KO
K06463  low affinity immunoglobulin gamma Fc receptor III
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04380  Osteoclast differentiation
ocu04613  Neutrophil extracellular trap formation
ocu04650  Natural killer cell mediated cytotoxicity
ocu04666  Fc gamma R-mediated phagocytosis
ocu05140  Leishmaniasis
ocu05150  Staphylococcus aureus infection
ocu05152  Tuberculosis
ocu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100337909
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100337909
   04650 Natural killer cell mediated cytotoxicity
    100337909
   04666 Fc gamma R-mediated phagocytosis
    100337909
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100337909
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100337909
   05152 Tuberculosis
    100337909
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100337909
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100337909
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100337909
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100337909
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
    100337909
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    100337909
CD molecules [BR:ocu04090]
 Proteins
  100337909
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
 Receptors
  100337909
SSDB
Motif
Pfam: Ig_2 Ig_3 Ig_4 V-set ig I-set Izumo-Ig
Other DBs
NCBI-GeneID: 100337909
NCBI-ProteinID: XP_002715293
Ensembl: ENSOCUG00000024349
UniProt: G1TR84
LinkDB
Position
13:31461109..31467851
AA seq 253 aa
MGQPLPPVALLLLVSASSRAADVPKALVLLDPPWASVLKDDHVTLKCQGLHPAGDNTTQW
LHNGSLLSSQAPAYTITAARAEDGGEYRCQTGLSSLSDPVQLHVHLGWLVLQAPRWVFQE
GEPIQLRCHSWKNNKLHKVTYLQNGRGLRYFHQNSDLHIPEATRNHSGSYFCRGLIGHHN
MSSETVTITVQGPANPVISSSVLPWHQIAFCLVMGLLLAADTGLYFSVQRDLRSSQRARK
EHTLGWSLGSQDK
NT seq 762 nt   +upstreamnt  +downstreamnt
atggggcagccgctgcccccagtggctctgctgcttctagtctcagcttcctcgcgggct
gcagatgtccccaaggcgctggtgctcctggaccctccgtgggccagcgtgctcaaggat
gaccatgtgactctcaagtgccaggggcttcaccctgctggggacaacaccacacagtgg
ctgcacaacgggagcctcctctccagccaggcccccgcctacaccatcacagctgccagg
gctgaagatgggggcgagtacaggtgccagacgggcctgtcctcgctcagcgacccggtg
cagctgcatgtccatctcggctggctggtgcttcaggccccgcggtgggtgttccaggaa
ggggagcccattcagctgaggtgccacagctggaagaacaataagctgcacaaggtcacc
tatctccagaatggcagaggcctgaggtatttccatcaaaattccgacctccacattcca
gaagccacgcgcaaccacagtggctcctacttctgcaggggcctcatcgggcaccacaac
atgtcctcggagactgtgaccatcactgttcaaggtccagcaaatccagtcatctcgtcc
tccgttctcccctggcaccagatcgccttctgcctggtgatgggactcctgcttgcagca
gacacggggctgtacttctccgtgcagagagacctccggagctcacagagggccaggaag
gagcacacactggggtggagcctgggctctcaggacaagtga

KEGG   Oryctolagus cuniculus (rabbit): 100338413
Entry
100338413         CDS       T03373                                 
Symbol
FCGR2A
Name
(RefSeq) Fc fragment of IgG receptor IIa
  KO
K06472  low affinity immunoglobulin gamma Fc receptor II-a
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04380  Osteoclast differentiation
ocu04611  Platelet activation
ocu04613  Neutrophil extracellular trap formation
ocu04666  Fc gamma R-mediated phagocytosis
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05150  Staphylococcus aureus infection
ocu05152  Tuberculosis
ocu05171  Coronavirus disease - COVID-19
ocu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100338413 (FCGR2A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100338413 (FCGR2A)
   04613 Neutrophil extracellular trap formation
    100338413 (FCGR2A)
   04666 Fc gamma R-mediated phagocytosis
    100338413 (FCGR2A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100338413 (FCGR2A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100338413 (FCGR2A)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100338413 (FCGR2A)
   05150 Staphylococcus aureus infection
    100338413 (FCGR2A)
   05152 Tuberculosis
    100338413 (FCGR2A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100338413 (FCGR2A)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100338413 (FCGR2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100338413 (FCGR2A)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100338413 (FCGR2A)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    100338413 (FCGR2A)
CD molecules [BR:ocu04090]
 Proteins
  100338413 (FCGR2A)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig Ig_4 V-set I-set Ig_5 DUF1565
Other DBs
NCBI-GeneID: 100338413
NCBI-ProteinID: XP_008262399
LinkDB
Position
13:complement(31481747..31490927)
AA seq 279 aa
MTLKNHMFQNVDRGSPWLLQPLTILLLLASADRTAAEVPQAVLKLQPPWIRVLQDDSVTL
TCQGAHGPGNHSTQWLHNGIAIPSQVQPSYTFKAKKNDSGEYRCQTGPSRLSNPVQLHVF
SEWLVLQTPQLVFQEGEPIMLRCHGWRNKTVNKVTFYQNGISKKFFNYNTDFSIAQANRS
HSGDYYCKGNIGKVTYSSEPVTITVQGHSMDRGLQQFTLQCLRLTLLVHIKIQNLGNLKK
NKMKRKIYRALAGNRTRASRVAGENSTTEPPMPEAGESV
NT seq 840 nt   +upstreamnt  +downstreamnt
atgaccctgaagaaccacatgtttcagaatgtggatcgcggcagcccatggcttcttcag
ccactgacaattctgctgctgttggcttctgcggacaggacagctgccgaggtcccgcag
gccgtgctgaagctccagccgccgtggatccgggtgctccaggacgactcggtgaccctg
acgtgtcagggggcccacggccccgggaaccactccacccagtggctccacaacggcatc
gccatccccagccaggtgcagcccagctacacgtttaaggccaagaagaacgacagcggg
gagtacaggtgccagacaggccccagcaggctcagcaaccccgtgcagctgcacgtgttt
tcggagtggctggtactccagacgcctcagttggtgttccaggagggggaacccatcatg
ctgaggtgccatggctggaggaacaagactgtgaacaaggtcacattctaccagaatgga
atatccaagaagtttttcaattacaacaccgacttctccatcgctcaagcaaaccgcagc
catagcggtgattactactgcaaaggaaacataggaaaggtgacctactcatcagagcct
gtgaccatcactgtccaaggtcatagcatggacaggggactacagcagttcactctccaa
tgtcttcggctgactttgcttgtacatattaaaattcaaaacttagggaacctcaagaaa
aataaaatgaaaagaaaaatataccgtgcattggccgggaatcgaacccgggcctcccgc
gtggcaggcgagaattctaccactgaaccaccaatgcccgaggcgggagagagtgtgtaa

KEGG   Oryctolagus cuniculus (rabbit): 100338913
Entry
100338913         CDS       T03373                                 
Name
(RefSeq) low affinity immunoglobulin gamma Fc region receptor III-B-like
  KO
K06463  low affinity immunoglobulin gamma Fc receptor III
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04380  Osteoclast differentiation
ocu04613  Neutrophil extracellular trap formation
ocu04650  Natural killer cell mediated cytotoxicity
ocu04666  Fc gamma R-mediated phagocytosis
ocu05140  Leishmaniasis
ocu05150  Staphylococcus aureus infection
ocu05152  Tuberculosis
ocu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100338913
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100338913
   04650 Natural killer cell mediated cytotoxicity
    100338913
   04666 Fc gamma R-mediated phagocytosis
    100338913
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100338913
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100338913
   05152 Tuberculosis
    100338913
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100338913
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100338913
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100338913
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100338913
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
    100338913
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    100338913
CD molecules [BR:ocu04090]
 Proteins
  100338913
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
 Receptors
  100338913
SSDB
Motif
Pfam: Ig_2 Ig_3 ig V-set Ig_4 I-set Izumo-Ig Ig_6
Other DBs
NCBI-GeneID: 100338913
NCBI-ProteinID: XP_002715295
Ensembl: ENSOCUG00000027815
UniProt: G1T7E7
LinkDB
Position
13:complement(31543347..31550215)
AA seq 253 aa
MGQPLPPVALLLLVSASSRAADVPKALVLLDPPWASVLKDDHVTLKCQGLHPAGDNTTQW
LHNGSLLSSQAPAYTITAARAEDGGEYRCQTGLSSLSDPVQLRVHLGWLVLQAPRWVFQE
GEPIQLRCHSWKNNKLHKVTYLQNGRGLRYFHQNSDLHIPEATRNHSGSYFCRGLIRHHN
VSSETVTITVQGPANPVVSSSVLPWHQIAFCLVMGLLLAADTGLYFSVQRDLRSSQRARK
EHTLGWSLGSQDK
NT seq 762 nt   +upstreamnt  +downstreamnt
atggggcagccgctgcccccagtggctctgctgcttctagtctcagcttcctcgcgggct
gcagatgtccccaaggcgctggtgctcctggaccctccgtgggccagcgtgctcaaggat
gaccatgtgactctcaagtgccaggggctccaccctgctggggacaacaccacacagtgg
ctgcacaacgggagcctcctctccagccaggcccccgcctacaccatcacagctgccagg
gctgaagatgggggcgagtacaggtgccagacgggcctgtcctcgctcagcgacccggtg
cagctgcgtgtccatctcggctggctggtgcttcaggccccgcggtgggtgttccaggaa
ggggagcccattcagctgaggtgccacagctggaagaacaataagctgcacaaggtcacc
tatctccagaatggcagaggcctgaggtatttccatcaaaattccgacctccacattcca
gaagccacgcgcaaccacagtggctcctacttctgcaggggcctcatcaggcaccacaac
gtgtcctcggagactgtgaccatcactgttcaaggtccagcaaatccagtcgtctcgtcc
tccgttctcccctggcaccagatcgccttctgcctggtgatgggactcctgcttgcagca
gacacggggctgtacttctccgtgcagagagacctccggagctcacagagggccaggaaa
gagcacacactggggtggagcctgggctctcaggacaagtga

KEGG   Oryctolagus cuniculus (rabbit): 100358696
Entry
100358696         CDS       T03373                                 
Name
(RefSeq) high affinity immunoglobulin gamma Fc receptor I
  KO
K06498  high affinity immunoglobulin gamma Fc receptor I
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04380  Osteoclast differentiation
ocu04613  Neutrophil extracellular trap formation
ocu04640  Hematopoietic cell lineage
ocu04666  Fc gamma R-mediated phagocytosis
ocu05140  Leishmaniasis
ocu05150  Staphylococcus aureus infection
ocu05152  Tuberculosis
ocu05202  Transcriptional misregulation in cancer
ocu05221  Acute myeloid leukemia
ocu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100358696
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100358696
   04613 Neutrophil extracellular trap formation
    100358696
   04666 Fc gamma R-mediated phagocytosis
    100358696
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100358696
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100358696
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100358696
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100358696
   05152 Tuberculosis
    100358696
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100358696
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100358696
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100358696
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100358696
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    100358696
CD molecules [BR:ocu04090]
 Proteins
  100358696
SSDB
Motif
Pfam: Ig_2 Ig_3 ig V-set I-set Ig_4 Peptidase_S49_N TMEM100 UPF0542
Other DBs
NCBI-GeneID: 100358696
NCBI-ProteinID: XP_008262732
UniProt: G1SJM8
LinkDB
Position
13:complement(42211232..42293835)
AA seq 397 aa
MWLWTALLLWVPVGGQEDPTKAVITLQPPWVDVFQEEAVTLQCEGPRQPGDSSAQWFLNG
TAIRTLTPRYYITGAQANDSGEYRCQTELSAPSEPVQLQAHRDWLLLQVSGRVFTEGEPL
TMRCHAWKNKIVYNVLFYQNGKAFKFSSQDSELTIPKTNVNHNGIYHCSAMGRYRYTSAG
VSVTVQELFRVPVLRASSPLPLQEGSAVTLSCETKLLPDSPPLRLYFSFYVGNKTVQARN
VSSQYQIPRVGGEDLGLYWCEAATEDGGVRKCSVVLELGVLGSQAPNPVWFHILFHLAMG
VIFLVSTVLCWIIYKELQRNKKENLKVSLSSDHGKNVTSYLHKDRYVEKELKFQEEKELQ
KEAHQKSKEGEGQQPKDEASPPALPLRPSARAHVSYN
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgtggctgtggacagctctgctcctgtgggttccagttggtgggcaagaggaccccacg
aaggccgtgatcaccctgcagcctccgtgggtcgatgtgttccaagaggaagccgtgacc
ttacagtgtgaagggccgcgtcagcctggggacagctctgcacagtggtttctcaacggc
acagccattcggaccctgacccccaggtactacatcactggtgcccaggccaatgacagt
ggtgaatacaggtgccagacggagctctcagcaccaagtgagcccgtgcagctgcaggcg
cacagagattggctgctgctccaggtctctggcagagtcttcaccgaaggggaacctctg
accatgaggtgtcatgcgtggaagaacaagatagtgtacaatgtgcttttctatcaaaac
ggcaaagcctttaagttttcttctcaggattctgaactcaccattccaaaaaccaacgtg
aatcacaatggcatttatcactgctcggccatgggaaggtatcgctacacatcagcagga
gtgtctgtcactgtgcaagagctctttcgggttccggtgctgagggcgtcctcccctctg
cccctccaggaggggagcgcggtgacgctgagctgtgagacgaagctgctcccggacagc
ccccccttgcgcctttacttctccttctacgtgggcaacaagaccgtgcaggccaggaac
gtatcctcccaataccagataccacgtgtcggaggggaggacttgggcttgtactggtgt
gaggcggccacggaggacggaggggtgcggaagtgcagcgtcgtgctggagctgggggtg
ctcggctcccaggcaccaaatcctgtctggtttcacatccttttccatctcgcaatggga
gtaatatttttggtgagcactgttctgtgttggataatatataaagaactgcaaagaaac
aaaaaggagaatttaaaagtctctttgtcttctgatcatgggaagaatgtaacttcctac
cttcacaaagacagatatgtagaaaaagagctaaagtttcaggaagaaaaagagctacaa
aaagaggcacatcagaagtccaaggagggagaggggcagcagccaaaggacgaagccagt
cccccagcccttcccctccggcccagtgccagggcacacgtatcctacaactga

DBGET integrated database retrieval system