KEGG   Oryctolagus cuniculus (rabbit): 100338696
Entry
100338696         CDS       T03373                                 
Symbol
CD209
Name
(RefSeq) CD209 molecule
  KO
K06563  C-type lectin domain family 4 member M
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04625  C-type lectin receptor signaling pathway
ocu05152  Tuberculosis
ocu05162  Measles
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100338696 (CD209)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100338696 (CD209)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100338696 (CD209)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100338696 (CD209)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100338696 (CD209)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ocu04054]
    100338696 (CD209)
   04090 CD molecules [BR:ocu04090]
    100338696 (CD209)
   04091 Lectins [BR:ocu04091]
    100338696 (CD209)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    100338696 (CD209)
Pattern recognition receptors [BR:ocu04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   100338696 (CD209)
CD molecules [BR:ocu04090]
 Proteins
  100338696 (CD209)
Lectins [BR:ocu04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    100338696 (CD209)
SSDB
Motif
Pfam: Lectin_C
Other DBs
NCBI-GeneID: 100338696
NCBI-ProteinID: XP_017193467
Ensembl: ENSOCUG00000010890
UniProt: G1T070
LinkDB
Position
Un
AA seq 239 aa
MNDTKAARVQPLDPLEEEDLIGGSPRDSRTDFGLGRVQGLKSFAGHLGRHRHLLLQFLCF
TLFTVLLVAILAQVSKVRSCHKQELSKEGEIVQDLRQLKAGVAHLCRRCSWDWTFFQEHC
YFFSKSQRNWHDSLSACQEMGAQLVIVQSAEEQSFLQQTSKSKGSTWMGLSDLNKEATWH
WVDGSALLLSFMKYWNPGEPNNHGEEDCGEFSGNGWNDNKCEVENFWVCKQPANSCADN
NT seq 720 nt   +upstreamnt  +downstreamnt
atgaacgacaccaaggctgcgagggtgcagccgctggaccccctagaggaggaagatctc
atcggaggcagcccccgagactccaggacagactttgggttgggaagggttcaaggtctc
aagagctttgcagggcatctcgggagacaccggcacctgctgctgcagttcctgtgcttc
acgctgttcactgtactcctggtggccatcctcgcccaagtctccaaggtccggagctgc
cacaaacaggagctgtcaaaggagggagagatcgtccaggatctgaggcagctgaaggca
ggagtggcccacctgtgccgccgctgctcctgggactggactttcttccaagaacactgc
tatttcttctccaagtcccagcggaactggcatgactccctctccgcgtgccaggaaatg
ggggcccagctggtcatcgtccaaagtgctgaggagcagtccttcctacagcagacctcc
aagtccaaaggctccacctggatggggctgtcagacctgaacaaggaggccacgtggcac
tgggtggatggctcagctctgctgctcagcttcatgaagtactggaacccaggagagccc
aacaaccacggcgaggaagactgcggggagttcagcggcaatggctggaacgacaacaag
tgcgaggtggagaatttctgggtgtgcaagcagcccgcaaactcctgcgccgacaactga

DBGET integrated database retrieval system