KEGG   Oryctolagus cuniculus (rabbit): 100338708
Entry
100338708         CDS       T03373                                 
Symbol
TIRAP
Name
(RefSeq) TIR domain containing adaptor protein
  KO
K05403  toll-interleukin 1 receptor (TIR) domain-containing adaptor protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04064  NF-kappa B signaling pathway
ocu04620  Toll-like receptor signaling pathway
ocu04936  Alcoholic liver disease
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100338708 (TIRAP)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100338708 (TIRAP)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100338708 (TIRAP)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100338708 (TIRAP)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100338708 (TIRAP)
   05133 Pertussis
    100338708 (TIRAP)
   05152 Tuberculosis
    100338708 (TIRAP)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100338708 (TIRAP)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100338708 (TIRAP)
SSDB
Motif
Pfam: TIR_2 TIR
Other DBs
NCBI-GeneID: 100338708
NCBI-ProteinID: XP_008257623
Ensembl: ENSOCUG00000012519
UniProt: G1T3H4
LinkDB
Position
1:complement(90791461..90802904)
AA seq 226 aa
MASSTSLPAPRSRPKKPLGKMADWFRQALQKKPAKMPGSPESAPSDSPRTPSQAGPAPSG
LSASTSPAPPAAHEGACSDSGTGSGRWSRDYDVCVCHSEEDLAAAQELVSYLEGSAASLR
CFLQLRDAAPGGAIVSELCQALSSSHCRVLLITPGFLRDPWCRYQMLQALSEAPGAEGRT
IPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVREAVLHYLRTLG
NT seq 681 nt   +upstreamnt  +downstreamnt
atggcatcatcgacctccctcccagctcctcgctcccggcccaagaagcctctgggcaag
atggctgactggttcaggcaggccctgcagaagaagcctgcgaagatgcctggctccccg
gagagcgcccccagcgacagcccgcgaaccccttcccaggcagggcccgcgccctcgggc
ctcagtgccagcacctcccccgccccgccagcggcacacgagggcgcctgcagtgacagc
ggcactggcagtggccgctggagccgggactacgatgtgtgtgtgtgccacagcgaggag
gacctggcggccgcccaggagctggtctcctacctggagggcagcgccgccagcctgcgc
tgcttcctgcagctgcgcgacgcagccccgggcggtgccatcgtgtctgaactgtgccag
gcgctgagcagcagtcactgccgagtactgctcatcaccccgggcttcctgcgcgacccc
tggtgcaggtaccagatgctgcaggccctgtccgaggccccaggtgccgagggccgcacc
atccctctgctgtccggcctgtctagagccgcctacccacccgagctccggttcatgtac
tacgtggacggcaggggccccgacggaggctttcgccaagtcagggaagcagtcctgcac
tatctacggacacttggttga

DBGET integrated database retrieval system