KEGG   Oryctolagus cuniculus (rabbit): 100340334
Entry
100340334         CDS       T03373                                 
Symbol
HSPG2
Name
(RefSeq) heparan sulfate proteoglycan 2
  KO
K06255  basement membrane-specific heparan sulfate proteoglycan core protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04512  ECM-receptor interaction
ocu05161  Hepatitis B
ocu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100340334 (HSPG2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100340334 (HSPG2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100340334 (HSPG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100340334 (HSPG2)
   00535 Proteoglycans [BR:ocu00535]
    100340334 (HSPG2)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100340334 (HSPG2)
Proteoglycans [BR:ocu00535]
 Extracellular matrix (ECM) proteoglycans
  Basement membrane proteoglycans
   100340334 (HSPG2)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig Laminin_B V-set Laminin_G_1 Laminin_G_2 Laminin_EGF C2-set_2 Ldl_recept_a Ig_6 Laminin_G_3 EGF hEGF
Other DBs
NCBI-GeneID: 100340334
NCBI-ProteinID: XP_017201975
Ensembl: ENSOCUG00000010955
LinkDB
Position
13:131388591..131490550
AA seq 4442 aa
MGRRAAGTLLLALLLHGRLLAVAHGLRAYEGLSLPEDTETVTEGRAGWSYSYLSDDEDLL
ADDASGDGLGSGDLGSGDFQMVYFRALVNFTHSIEYSPRLEDAGSREFREVSDAVVDKLE
MEYAKIPGDQVVSVVFIKELDGWVFVELDVGSEGNADGAQIQDVLHRVVSGGAIASYVTS
PQGFQFRRLGTAQTPPPPPAAVGVTVTSVPQIPRVCTEAEFACHSHNECVALEYRCDRRP
DCRDMSDELNCEEPIPALSTTKPFLETPSFPPQPEVATQRPPDMAIPQPLFPSLGRPEPC
GPQEAACHSGHCIPKDYVCDGQEDCTDGSDELDCGPTPPCEPNEFPCGNGHCALKLWRCD
GDFDCEDRTDEANCPAKRPEEVCGPTQFRCVSTSTCIPASFHCDEESDCPDRSDEFGCMP
PQVVTPPQESIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTMTSEGGRGTLI
IRDVKESDQGAYTCEAMNARGMVFGIPDGVLELIPQRGPCPDGHFYLEPSASCLPCFCFG
VTNVCQSSRRFRHQIHLRFDQPGDFKGVNVTMPAQPGMPPLSSTQLHIDTALQEFQLVDL
SRRFLVHDSFWALPEQFLGNKVDSYGGSLRYKVRYDLARGMLEPVQRPDVVLVGAGYRLL
SRGHTPTQPGALNQRQVQLSEEHWVHESGRPVQRAEMLQVLQSLEAVLIQTVYNAKMASV
GLSDISMDTTVTYATSHGRAHSVEECRCPVGYSGLSCESCAAHFTRVPGGPYLGTCSGCN
CNGHASSCDPVYGHCLNCQHNTEGPQCNKCKAGFFGDATKATATACRPCPCPYIDASRRF
SDTCFLDTDGQATCDACAPGYTGRRCESCAPGYEGNPIQPGGKCRPTTQQLVRCDERGSL
GTAGEACQCKNNVVGRLCNECADGSFHLSTQNPDGCLRCFCMGVSRQCSSSSWSRAQVLG
ASEEPAQFSLTNAAGTHTTSEGIASPTAGELLFSSFHSLLQGPYFWSLPPRFRGDKVTSY
GGELRFTVTQQPQPGSPPLHGQPLVVLQGNSITLEHRTSQEPVPGQPSSFTIPFREQAWQ
RPDGQPATREHLLMALAGIDALLIRASYSQRPAESRVSGISMDVAVPEGTGQDPALEVEQ
CTCPPGYRGPSCQDCDTGYTRMPSGLYLGTCERCSCHGHSEACEPETGACQGCQHHTEGP
RCQQCQPGYYGDAQQGTPQDCQPCPCYGAPAAGQAAHTCFLDTDGHPTCDACSPGHSGRL
CERCAPGYHGNPSQGQPCQRDGQVPEPIGCGCDPQGSVSSQCDATGQCQCKAQVEGLTCS
HCRPHHFHLSASNPDGCLPCFCMGVTQQCASSSYTRHLISSRFAPGDFQGFALVNPQRNS
RLTGGFTVEPAPEGAQLSFGNFAHLGQEPFYWQLPDAYQGDKFALSYEGFSLLPGSLYYW
QLPQAFLRDKVAAYGGKLRYTLSYTAGPQGSPLSDPDIQITGNNIMLVASQPPPQGAERR
SYEIVFREEFWRRPDGQPATREHLLMALADLDEILVRATFSSVPLAASISAVSLEVAQPG
PSDGPRALEVEECRCPPGYVGLSCQDCAPGYTRTGSGLYLGHCELCECNGHSDVCHPETG
ACSQCQHNAAGEFCELCAPGYYGDATAGTPEDCQPCACPLTNPENMFSRTCESLGGNGYR
CTACEPGYTGQYCEQCAPGYVGNPNVQGGRCLPQADQAPLVVQVHPARSVVPQGGPYSLR
CQVSGSPPHYFYWSREDGRPVPSSTQQRHQGSELHFPSVQPSDAGVYICTCRNLHHANSS
RAELLVTEAPSKPITVTVEEQRSQSVRPGADVTFICTAKSKSPAYTLVWTRLHNGKLPSR
AMDFNGILTIRGVQPSDAGTYVCTGSNMFAMDQGTATLHVQASPTSSAPTVSIHPPQLTV
QPGQMAEFRCSATGNPMPNLEWIEGPGGQLPQKAEVRGGILRLPAVEPSDQAPYLCRAHN
SAGQHVARAVLHVHGGSGPRVQVSPERTQVHEGHTVRLYCRAAGVPSATITWRKEGGSLP
PQARSERTDIATLLIPAITAADAGFYLCVATSPAGTAQARIQVVVLTASGDSSPPPVRIE
SSSPSVTEGQTLDLNCVVAGSAHTQVTWYRRGASLPPRSQVHGSRLRLPQVSPADSGEYV
CRVENGSGPKEATITISVLRGTHTGPSHAPAPGSTQPIRIESSSSHVAEGQTLDLNCVVP
GQAHAQVTWHRRGGSLPARHQTHGSLLRLHQVSPADSGEYVCRVLLGSEHLETSVLVSIE
ASGSMPAPGPIPPVRIESSSSTVAEGQTLDLSCVVAGQAHAQVTWYKRGGSLPARHQVRG
SRLYIFQTSPADAGEYVCRASNGAEASITVTVTRTQGANFAYPPGTQPIRIESSSSHVAE
GQTLDLNCVVPGQAHAQVTWHKRGGSLPARHQTHGSLLRLHQVSPADSGEYVCRVLGGSV
PLESSVLVTIEPADSVPAHGVTPPVRIESSSSHVAEGQTLDLNCVVPGQAHAQVTWHKRG
GSLPARHQVHGSRLRLPQVTPADSGEYVCRVVSSSGTQEASVLVTIQRRLGPSHPQGVVY
PVRIESSSASLANGNTLDLNCLVASQAPHTITWYKRGGSLPSRHQIVGSRLRIPQVTPAD
SGEYVCHVSNGAASQETSLIVTIQGSGPPHVPSVSPPIRIESSSPTVVEGQTLDLNCVVA
GQPQATITWYKRGGSLPSRHQTHGSHLRLHHMSVADSGEYVCRANNNIDAQEASIMVSVS
PSPSNPSAPGAATPIRIESSSSHVAEGQTLDLNCVVPGQAHAQVMWYKRGGSLPTHHQTH
GSHLRLYQVSPADSGQYVCRVLGSSGPLEASVLVTIEASDANPVRIPAPGGAPPIRIETS
SSHVAEGQTLDLNCVVPGQAHAQVTWHRRGGSLPAGHQVHGHILRLNQVSPADSGEYSCR
VTGSSGTLEASVLVSIEPSSPSPIPAPGLAQPIHIEASSSHVAEGQTLDLNCVVPGQAHA
QVTWYKRGGSLPARHQTHGSRLRLHHVSPADSGEYVCRVAGGSGPEQEASFTVTVPPSEG
SSYRLRSPVISIDPPSSTVQQGQDASFKCLIHDGATPISLEWKTRNQELEDNVHISPNGS
VITIVGTRPSNHGAYRCVASNAYGVAQSVVNLSVHGPPTVSVLPEGSVRVKMGKDVTLEC
VSSGEPRSSARWTRVGYPARLEPRTYGMVDSHAVLKISSVKPSDAGTYVCLAQNALGTAR
KEVEVIVDTGTSAPGAPQVQVEEVELTVEAGHTATLRCSASGSPTPTIQWSKLRSPLPWQ
HRLEGNTLLIPRVAQQDSGQYICNATSPLGHAEATVILHVESPPYATVVPEHASVRAGER
VQLQCLAHGTPPLTFQWSRMDGSLPGRAAASKELLHFEPAAPEDSGRYRCQVSNKVGLAE
AFAQVLVQGPSDTLPDTATPAGAPPTVQVTPQQETRSIGASVEFHCAVPSDRGTQLRWFK
EGGQLPPGHSVQDGVLRIQNLDQSCQGTYVCQAHGPWGQAQASAQLVVQALPSVLINIRT
SVQTVVVGHAVEFECMARGDPKPQVTWSKVGGRLRPGIVQSGSVIRIPHVELADAGQYRC
TATNAAGTTQSHVLLLVQALPQISTPPEVRVPAGSAAVFPCMASGYPTPDITWSKLDGSL
PPDSRLENNMLVLPSVRPQDAGTYICTATNRQGKVKAFAHLQVPERVVPYFTQTPYSFLP
LPTIKDAYRKFEIKITFRPDSADGLLLYSGMLLYNGQKRTPGSPTNLANRQPDFISFGLV
GGRPEFRFDAGSGMATIRHPTPLALGQFHTVTLLRSLTQGSLIVGNLAPVNGTSQGKFQG
LDLNEELYLGGYPDYGAIPKAGLTSGFVGCVRELRIQGEEIIFHDLNLTAHGISHCPTCR
DRPCQNGGQCHDSESSSYVCVCPAGFTGSRCEHSQALHCHPEACGPDATCVNRPDGRGYT
CRCHLGRSGPRCEEGVTVTTPSMSGAGSYLALPALTNTHHELRLDVEFKPLAPDGILLFS
GGKSGPVEDFVSLAMAGGHLEFRYELGSGLAVLRSPEPLALGRWHRVSAERLNKDGSLRV
NGGRPVLRSSPGKSQGLNLHTLLYLGGVEPSVPLSPAANVSAHFRGCVGEVSVNGKRLDL
TYSFLGSQGVGQCYDSSPCERQPCQNGATCMPAGEYEFQCLCRDGFKGDLCEQEENPCQL
HEPCLHGGTCQGTRCLCLPGFSGPRCQQGPGHGLAESDWHLEGSGGSDAPGQYSAYFHDG
GFLALPGHVFSRSLPEVPETIELEVRTSTASGLLLWQGVEMGEASRGKDFIGLGLQDGHL
VFSYQLGSGEARLVSEDPINDGEWHRVTALREGRRGSIQVDGEELVSGQSPGRNVAVNTK
GSVYVGGAPDVAALTGGRFSSGITGCIKNLVLHSARPGGPPPQPLDLQHRAQAGANTRPC
PS
NT seq 13329 nt   +upstreamnt  +downstreamnt
atggggcggcgggcggcgggcacgctgctgctggcgttgctgctgcacgggcggctgctc
gcggtggcccacgggctgagggcatatgagggcttgtctctgcccgaggacacagagacc
gtcacagagggccgagccggctggagctattcctacctgtctgatgacgaggacctgctg
gctgatgatgcctctggagatggcctgggcagcggggacctgggcagtggggacttccag
atggtgtacttccgggccctggtgaatttcacgcactccatcgagtacagccctcggctg
gaggatgcaggctccagggagttccgggaggtgtcggatgccgtggtggacaagctggag
atggagtacgcgaagattcctggagaccaggtggtcagcgtggtgttcatcaaggagctg
gacggctgggtctttgtggagctggacgtgggctcagaaggcaatgcggatggcgcccag
attcaggacgtgctgcacagggtcgtctccggcggtgccatcgcctcctacgtcacgtcc
ccccaggggttccagttccgacgcctgggcaccgcacagacccccccgccccctccggcc
gccgtgggggtcacagtgacgtcagtgccccagatcccgagggtctgcaccgaggccgag
tttgcctgccacagccacaacgagtgtgtggccctggagtatcgctgtgaccggcggccc
gactgcagggacatgtcggatgagctcaactgcgaggagccgatcccagcgctcagcacc
acgaagccctttttggagacaccgtctttcccgccccagccagaggtcgccacacagcgg
ccaccagacatggccattccccagcctctgttccccagtctaggcaggcctgagccctgt
gggccccaggaggctgcatgccacagcgggcactgcatccccaaagactacgtctgtgac
gggcaggaagactgcacggatggcagcgacgagctggactgcggccccacaccgccctgt
gagcccaatgagttcccctgcggaaacgggcactgtgccctcaagctgtggcgctgcgat
ggcgactttgactgtgaggaccgcaccgacgaggccaactgccctgccaagcgtcccgag
gaggtgtgtggccccacccagttccgctgcgtgtccaccagtacttgcatcccagccagc
ttccactgtgatgaggagagcgactgtcccgaccgcagcgacgagtttggctgcatgccc
ccgcaggtggtgacccctccccaggagtcgatccaggcttcgcggggccagacagtgacc
ttcacttgtgtggccattggggtccccacccccatcatcaactggaggctcaactggggc
cacatcccctctcaccccagggtgacaatgaccagcgagggcggccgtggcaccctgatc
attcgcgatgtgaaggagtcagaccagggtgcttacacctgtgaggccatgaacgcccgg
ggcatggtgttcggcatccctgacggcgtcctggagctcatcccgcagcgaggcccctgc
cccgacgggcatttctacctggagcccagcgcctcctgcctgccctgcttctgcttcggg
gtcaccaacgtgtgccagagcagccgccgcttccgccaccagatccacctgcgctttgac
cagcccggcgacttcaagggtgtgaacgtgacgatgcccgcgcagcccggcatgccgccc
ctgtcctccacccagctgcacatcgacaccgccctgcaggagttccagctggtcgacctg
tcccgtcgcttcctcgtccacgactccttctgggctctgcctgagcagttcctgggcaac
aaagtggactcctatggcggctccctgcgctacaaggtgcgctatgacctggcacgtggc
atgctagagccggtgcagcggccagacgtggtcctcgtgggtgctgggtatcgcctgctc
tcccgaggccacacgcccacccaacccggtgccctgaaccagcgccaggtccagctctct
gaggagcactgggtccacgagtctggacggccagtgcagcgggcggagatgctgcaggta
ctgcagagcctggaggccgtgctcatccagaccgtgtacaacgccaagatggccagcgtg
gggctgagcgacatcagcatggacaccaccgtcacctatgccaccagccacggccgcgca
cacagtgtggaggagtgcagatgccccgtcggctattccggcttgtcctgcgagagctgc
gctgcccacttcacccgggtacccggtgggccttacctgggcacctgctctggctgcaac
tgcaatggccatgccagctcctgtgaccctgtgtacggccactgcctgaactgtcagcac
aacacggagggaccgcagtgcaacaagtgcaaggccggcttctttggggacgcgaccaag
gccacggccactgcctgccggccctgcccttgcccgtacatcgatgcctcccgcagattc
tcggacacttgcttcctggacacggatggccaagccacatgtgacgcgtgtgcccctggc
tacacaggccgccgctgtgagagctgtgcccccggatatgagggcaaccccatccagccg
ggcgggaagtgcaggcccaccacccagcagcttgtgcgctgtgatgaacgaggcagcctg
gggaccgccggggaggcctgccagtgtaagaacaacgtggtggggcggctgtgcaatgag
tgtgccgacggctcattccacctgagcacgcaaaaccccgacggctgcctcaggtgcttc
tgcatgggggtcagtcgccagtgttccagctcttcctggagccgcgcccaggtgctgggg
gcctccgaggagcccgcgcagttcagcctgaccaacgctgcgggcacccacaccaccagc
gagggcatcgcctcccccacagccggggagctgctcttctcctccttccacagcctcctg
cagggaccctacttctggagcctccctccgcgcttccggggagacaaggtgacctcctac
gggggagagctgcgtttcacagtgacccagcagccccagcccggctccccgccgctgcac
gggcagcccctggtggttctgcagggcaacagtatcaccttggagcatcgcacctcccag
gaacctgtccccggccagcccagctccttcactatacccttccgggagcaagcatggcag
cggcctgacgggcagccagccacacgggagcacctgctgatggcactggcgggcattgac
gcgctcctgatccgggcatcctacagccagcggccggccgagagcagggtgtctggcatc
agcatggatgtggctgtgcccgagggcactggccaggaccctgcactagaagtggagcag
tgtacctgtccacctgggtaccgtggcccgtcctgccaggactgtgacacaggctacaca
cgcatgcccagcggcctctacctgggcacctgcgaacgctgcagctgccacggccactcg
gaggcctgcgagcctgagacaggtgcctgccagggctgccagcaccatacagagggccct
cggtgccagcagtgccagccaggatactatggggatgcccagcaggggacaccacaggac
tgccagccttgcccgtgctacggagcccctgctgccggccaggctgctcacacgtgcttc
ctggacactgatggccaccccacctgcgacgcctgctccccgggccacagcgggcggctc
tgtgagaggtgtgcccccggctaccacggcaaccccagccagggccagccgtgccagaga
gacggccaggtgccagagcccataggctgtggctgtgacccccagggcagcgtcagcagc
cagtgtgatgccactggccagtgccagtgcaaggcccaggtcgaaggcctcacctgcagc
cactgccggccccaccacttccacctgagtgccagcaaccccgacggctgcctgccctgc
ttctgcatgggcgtcacccagcagtgcgccagctcctcctacacgcgccacctgatctcc
agccgctttgctcctggcgacttccaaggctttgccctggtgaaccctcagcgcaacagc
cgcctgacgggaggcttcaccgtggaacccgcgcccgagggggcccagctctctttcggc
aacttcgcccacctcggccaggagcccttctattggcagctgccggacgcataccaggga
gacaagttcgctctctcctacgaaggcttctctctgctccctgggagcctctattactgg
cagctgccccaggccttcctgagggacaaggtggcggcttacggcgggaaactgcgctac
accctctcctacacggcgggaccgcagggcagccccctctctgaccctgacatccagatc
acgggtaacaacatcatgctggtagcctcccagcctcccccgcagggcgctgagaggagg
agctatgagatcgtcttcagagaggaattctggcgccggcctgacgggcagccagccacc
cgcgagcacctcctgatggcgctggccgacctggacgagatcctggtgcgcgccacgttc
tcctccgtgccgcttgcagccagcatcagcgctgtcagcctggaagtcgcccagcccggg
ccctcagacggaccccgggcccttgaagtggaggagtgccgctgtcccccgggctacgtg
ggcctgtcctgccaggactgtgcccctggctacacgcgcactgggagtgggctctacctc
ggccactgcgagctgtgtgaatgcaatggccactcagacgtgtgccacccagagaccggg
gcctgctcgcaatgccagcacaacgccgccggggagttctgcgagctgtgtgcccccggc
tactacggagacgccacggccgggacgcctgaggactgccagccctgtgcctgcccactg
accaatccggagaacatgttctcccgcacctgtgagagcctgggaggcaatgggtaccgc
tgcacagcctgtgagcccggctacaccggccagtactgcgagcagtgcgccccaggttat
gtgggtaaccccaacgtgcaagggggccggtgcctgccccaggcagaccaagccccgctg
gtggtccaggtccaccctgctcggagtgtcgtgccccagggcggcccctactccctgcgg
tgccaggtcagtgggagccccccacactacttctactggtcccgtgaggacgggcggcct
gtgcccagcagcacccagcagcgacatcaaggctccgagctccacttccccagtgtccag
ccctcggacgccggggtctacatttgcacctgccgtaatctccaccatgccaacagcagc
cgggcagagctgctggtcactgaggctccgagcaaacccatcacagtgactgtggaggag
cagcggagccagagcgtgcgccccggggccgacgtcaccttcatctgcactgccaaaagc
aagtccccagcctacacgctggtgtggacccgcctgcacaacggcaagctgccctcgcga
gccatggatttcaatggcatcctgaccatccgtggcgtgcagccgagtgacgcgggcacc
tacgtgtgcactggctccaacatgttcgccatggaccagggcaccgccacactgcacgtg
caggcctcgcccacctcgtctgcccccacggtctccatccaccccccgcagctcacggtg
cagcccggccagatggccgagttccgctgcagcgccaccgggaaccccatgcccaacctc
gagtggatagagggccccggcggccagctccctcagaaggccgaagtccgcggcggcatc
ctgcgcctgccggccgtcgagccctccgatcaggcgccgtacctgtgcagagcccataac
agcgccgggcagcacgtggccagggccgtgctccacgtccacgggggcagtggtcctcgg
gtccaggtgagcccagagaggacacaggtacacgaaggccacaccgtgaggctgtactgc
agggctgctggggtgcccagtgccaccatcacctggaggaaggaagggggcagcctcccc
ccacaggcccggtctgagcgcacggacatcgccacgctgctcatcccagccatcaccgcc
gccgacgccggcttctacctctgtgtggccaccagccctgcaggcactgcccaggcccgc
atccaggtggtcgtccttacagcctcaggcgacagctcaccgcctccggtcaggatcgag
tcctcctcgccatccgtgacagaaggacagacactcgacctcaactgcgtggtggcaggg
tcggcccacacccaggtcacgtggtacaggcgaggggccagcctgcctccccgctcacag
gtgcacggctcccggctgcggctccctcaggtctcccccgctgattcgggagaatacgtg
tgccgagtggagaacggctcgggccccaaggaggccaccatcaccatctctgtcctccgc
ggcacccatacaggccccagccatgccccagctccaggcagcacccagcccatccgcatc
gagtcctcctcctcccacgtggccgaagggcagacgctggatctgaactgtgtggtgccc
gggcaggcccacgcccaggtcacgtggcataggcgtgggggcagcctccccgcccggcac
cagacccacggctcactgctgcggctgcaccaggtgtcccccgccgattcgggcgagtac
gtgtgccgcgtgcttctgggttcggagcacctagagacctctgtcctggtctccatcgag
gcttcgggctccatgcctgccccaggacctatcccacctgtccggatcgagtcttcttcc
tccacggtggccgaggggcagaccctggatctgagctgcgtggtggctggacaggcccac
gcccaggtcacgtggtacaagcgcgggggaagcctacccgcccggcaccaggtccgcggc
tcccgcctgtacatcttccagacctcccctgccgatgctggggagtatgtttgccgggcc
agcaatggtgcggaggcctccatcaccgtcacagtaaccaggacccagggggccaacttt
gcctacccccctggcacccagcccatccgcatcgagtcctcctcctcccacgtggccgag
gggcagacgctggatctgaactgcgtggtgcctggccaggcccacgcccaggtcacgtgg
cacaagcgtgggggcagcctccctgcccggcaccagacccacggctcgctgctgcggctg
caccaggtgtcccctgccgactcaggcgagtatgtgtgccgcgtgctggggggctccgtg
cccctggagtcctccgtcctggtcaccattgagcctgcagactctgtgcctgcacacgga
gtcacacccccagtccggattgagtcatcgtcctcccacgtggccgaggggcagaccctg
gatctgaactgcgtggtgcctggccaggcccatgcccaggtcacgtggcacaagcgtggg
ggcagcctccccgcccggcaccaggtacatggctcaaggctgcggctgccccaggtgacc
ccagccgactccggggagtacgtgtgtcgtgtggtcagcagctcgggcacccaggaagcc
tcagtcctcgtcaccatccagcggcgcctgggcccctctcacccccagggtgtggtgtac
cccgtccgtatcgagtcctcctccgcctcgctggccaatggcaataccctggaccttaac
tgcctggttgccagccaagcccctcataccatcacctggtacaagcgtggaggcagctta
cccagtcggcaccagatcgtgggctcccggctgcggatcccccaggtgacccccgcggac
tctggcgagtacgtgtgccacgtcagtaacggggccgcttcccaggagacttcgctcatc
gtcaccatccagggcagtggccccccccacgtgcccagcgtctccccgcccatcaggatc
gagtcctcgtcccccaccgtggtggaaggccagaccttggatctgaactgcgtggtcgcc
gggcagccgcaggctaccatcacgtggtacaagcgtgggggcagccttccctcccgacac
cagacccacggctcccacctgcgcttgcaccacatgtctgtggccgactcgggcgagtac
gtgtgccgggccaacaacaacatcgatgcccaggaggcctccatcatggtctccgtctcc
cccagccctagcaacccctctgcccccggcgccgccacgcccatcagaatcgagtcctcc
tcctcccacgtggccgaagggcagaccttggatctgaactgcgtggtccctgggcaggcc
cacgcccaggtcatgtggtacaaacgtggaggcagcctccccactcaccatcagacccac
ggctcccatctgcggctgtaccaggtgtccccagccgactcgggccagtacgtgtgccgt
gtgctgggcagttctggccctctggaggcctcggtcctggtcaccatcgaggcctctgac
gctaaccctgtccgcatccctgcccctggcggagccccacccatccgcatcgagacctct
tcctcccacgtggccgaagggcagaccctggatctgaactgcgtggtacctggccaggcg
cacgcccaggtcacgtggcataggcgtgggggcagcctccccgctgggcaccaggttcac
ggccacatcctgaggctgaaccaggtatccccagccgactctggcgagtactcctgccgt
gtgaccggcagctcaggcaccctggaggcttctgtcctggtctccatcgaaccctcgagc
cccagccccattcctgccccaggactggcccagcccatccacatcgaggcctcctcctcc
cacgtggccgaggggcagacgctggacctgaactgcgtggtgcccgggcaggcccacgcc
caggtcacgtggtacaagcgcggaggcagcctccctgcccggcaccagacccatggctcc
cggctacggctccaccacgtgtcccccgccgactcaggcgagtacgtgtgccgagtggca
ggcggctcgggccctgagcaggaggcctccttcacagtcactgtcccgcccagcgagggg
tcttcttaccgccttaggagcccggtcatctccatcgacccgcccagcagcaccgtgcag
cagggccaagatgccagcttcaagtgcctcatccacgacggggccacccccatcagcctg
gagtggaagacgcggaaccaggaactggaagacaacgtccacatcagccccaatggctcc
gtcatcaccatcgtgggcacccggcccagcaaccacggggcctaccgctgtgtggcctcc
aacgcctatggcgtggcccagagtgtcgtgaacctcagtgtgcacgggccccctacagtg
tccgtgctccccgagggctccgtgcgagtgaaaatgggaaaggatgtgaccctggagtgt
gtcagcagcggggagccccgctcctccgctcgctggacccgggtgggataccccgcaagg
ctggagccacggacgtacgggatggtggacagtcacgcggtgctcaagatttcatcagtt
aaaccatcagacgcgggcacctacgtgtgcctagcgcagaatgcactgggcacagcacgg
aaggaagtggaggtgatcgtggacacgggcacctcggccccaggcgccccccaggtccag
gtggaagaagtggagctgaccgtggaggctggacacacagccaccctgcgctgctcggcc
tcaggcagccccacacccaccatccagtggtccaagctgcgctccccactgccctggcag
caccggctggaaggcaacaccctgctcatcccccgggtcgcccagcaggactcgggccag
tacatctgcaacgccaccagccctctggggcacgccgaggccaccgtcatcctgcatgta
gagagcccaccgtatgccaccgtagtcccggagcacgcctcggtgcgggctggagagaga
gtgcagctgcagtgcctggcacacggcacgcccccgctcaccttccagtggagccgcatg
gacggcagcctccccgggcgggcagctgccagcaaggagttgctgcacttcgagcccgcg
gcccctgaggactcaggtcgctaccgctgccaggtctccaacaaggtgggcttggccgaa
gcctttgcccaggtgctcgttcaaggtccctccgacaccctccctgacacggccacccca
gcaggagccccgcccaccgtgcaggtcacccctcagcaggagaccaggagcattggggcc
agcgtggagttccactgcgcagtgcccagcgaccggggcacccagctccgttggttcaag
gaagggggccagctgcctcccggccacagcgtgcaagacggggtgctccgaatccagaac
ctagaccagagctgccaagggacatatgtctgccaggcccatggaccttggggacaggcc
caggccagtgcccagctggtcgtccaagccctgccctccgtgctcatcaacatccggacc
tccgtgcagaccgtggtggtcggccatgctgtggagttcgagtgcatggcgcggggtgac
cccaagcctcaggtgacatggagcaaagtcggagggcgcctgcggcccggcatcgtgcag
agcggcagcgtcatcaggatcccccacgtggagctggccgacgccggacagtaccgctgc
accgccaccaacgccgccggcaccacgcagtcccatgtgctgttgctcgtgcaagccttg
ccccagatctccacacccccagaagtccgtgtgcctgctggctctgcagctgtcttcccc
tgcatggcctcgggctaccccacacccgacatcacctggagcaagctggacggcagcctg
ccgcccgacagccgcctggagaacaacatgctggtgctgccctcggtgcggccgcaggat
gccggcacctacatctgcactgccaccaaccgccagggcaaggtgaaagctttcgcccat
ctgcaggtaccagagcgggtggtgccctacttcacccagaccccctactccttcctgccg
ctgcccaccatcaaggatgcttacaggaagtttgagatcaagatcaccttccggccggac
tcagccgacggccttcttctctactcggggatgctactgtacaatgggcagaagcggacc
ccagggagccccaccaacctggccaacaggcagcccgacttcatctccttcggccttgtg
ggcggaagacccgagttccggtttgacgcaggctccggcatggccaccatccgccacccc
accccgctggccctgggccagttccacactgtgaccctgctgcgcagcctcacccagggc
tccctgatcgtgggcaacctggcccctgtcaacgggacctcccagggcaagttccagggc
ctggacctgaacgaggagctctatctaggcggctaccctgactacggggccatccccaag
gcaggcctgaccagcggctttgtaggctgtgtccgggagctgcgtatccagggcgaggag
atcatcttccatgacctcaacctcaccgcgcacggcatctcccactgcccgacctgtcgg
gaccggccctgccagaacgggggccagtgccacgactcggagagcagcagctatgtgtgc
gtatgcccggctggcttcaccgggagccgctgtgagcactcgcaggccctgcactgccac
ccagaggcctgtgggccagacgccacctgtgtgaaccggcccgatggtcggggctacacc
tgccgctgccacctgggccgctcggggccgaggtgtgaggaaggtgtgacagtgaccacc
ccctccatgtcgggcgccggctcctacctggcactgcccgccctcaccaacacacaccac
gagctacgcctggacgttgagttcaagccgctggcgcccgatgggatcttgctgttcagc
ggggggaagagcgggcctgtggaggatttcgtgtccctggcgatggctggtggccacctg
gagttccgctatgaactggggtcagggctggctgttctgcggagccccgagccgctggcg
ctgggccgctggcaccgcgtgtctgctgagcgcctcaacaaggacggcagcctgcgggtg
aacggcggccgccccgtgctccgctcctctcccggcaagagccagggcctcaacctgcac
accctcctctacctgggtggcgtggagccctccgtgccgctgtccccggccgccaacgtc
agtgctcacttccgcggctgcgtgggcgaggtgtctgtgaacgggaagcggctggacctc
acctacagcttcctcggcagccagggcgtcgggcagtgctacgacagctccccgtgtgag
cgccagccttgccagaacggtgccacctgcatgcccgctggcgagtacgaattccagtgc
ctgtgtcgcgacggcttcaaaggtgacctctgtgagcaggaggagaacccttgccagctc
cacgagccttgtctgcatgggggcacctgccagggcacccgctgcctctgtctccctggc
ttctcgggcccacgctgccagcaaggtcctggacatggcctcgcggagtccgactggcac
ctggaaggcagcgggggcagcgacgccccgggccagtacagcgcctacttccacgacggc
ggcttcctggccctcccgggacatgtcttctccagaagcctgccggaggtgcccgagacc
atcgagctggaggttcggaccagcacagccagcggcctcctgctctggcagggagtggag
atgggagaggccagccgaggcaaggacttcatcggccttgggcttcaggatgggcacctt
gtcttcagctaccagctgggcagtggggaggcccgccttgtctctgaggaccccatcaat
gacggcgagtggcatcgggtgacggcgctgcgagagggccgccgaggctccatccaggtg
gacggtgaggagctggtcagcggccagtccccaggccggaacgtggcagtcaacaccaaa
ggcagcgtctacgtgggcggagcccccgacgtggccgctctcactggaggcaggttctcc
tcgggcatcacgggctgcatcaagaacctggtgctgcactcggcccggcccggcggccca
cccccacagcccctggacctgcagcaccgcgcccaggctggggccaacacgcgcccctgc
ccctcgtag

DBGET integrated database retrieval system