KEGG   Oryctolagus cuniculus (rabbit): 100341085
Entry
100341085         CDS       T03373                                 
Symbol
WASHC3, CCDC53
Name
(RefSeq) WASH complex subunit 3
  KO
K18463  WASH complex subunit CCDC53
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100341085 (WASHC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100341085 (WASHC3)
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Others
   WASH complex
    100341085 (WASHC3)
SSDB
Motif
Pfam: CCDC53 NB-LRR GRDA
Other DBs
NCBI-GeneID: 100341085
NCBI-ProteinID: XP_002711272
Ensembl: ENSOCUG00000015171
UniProt: G1T8V9
LinkDB
Position
4:complement(81301280..81340670)
AA seq 191 aa
MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLANLSLRIQ
QIETTLNILDAKLSSIPGLDDVRFEVSPLGVTNDSHSEATSEPSQQNSTQDCGPQENEVS
AENILTVAKDPRYARYLKMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGESEKTIE
ESSDSESSFSD
NT seq 576 nt   +upstreamnt  +downstreamnt
atggatgaggatgggcttccactcatggggtcgggcatagacctgaccaaggtgccagct
attcaacagaaaagaacggtggcatttcttaaccagtttgtggtgcacactgtacagttc
ctcaaccgcttttcgacagtgtgtgaggagaaactggcaaacctttctcttcgtatccag
caaattgaaacaactctcaacattttagatgcaaagttgtcttctatcccgggcctagat
gatgtcagatttgaagtatctcctttaggtgtcacaaatgattcacattctgaagccact
tcagaaccatcacaacagaacagtacacaagactgtggaccacaggaaaatgaagtatca
gcagaaaatatcttaactgtagccaaggatccaagatatgccagatatctcaaaatggtt
caagtgggtgttccagtgatggcaataagaaacaaaatgatatctgaaggtctagatcca
gatcttcttgagaggccagatgctccagtgcctgatggtgaaagtgagaaaactatagaa
gaaagttcagatagtgaatcttctttcagtgactaa

DBGET integrated database retrieval system