KEGG   Oryctolagus cuniculus (rabbit): 100341281
Entry
100341281         CDS       T03373                                 
Symbol
IL1RAP
Name
(RefSeq) interleukin 1 receptor accessory protein
  KO
K04723  interleukin 1 receptor accessory protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04659  Th17 cell differentiation
ocu04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100341281 (IL1RAP)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100341281 (IL1RAP)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100341281 (IL1RAP)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100341281 (IL1RAP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100341281 (IL1RAP)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL1 receptor family
   100341281 (IL1RAP)
SSDB
Motif
Pfam: TIR Ig_3 Ig_2 TIR_2 ig I-set Ig_6
Other DBs
NCBI-GeneID: 100341281
NCBI-ProteinID: XP_008264877
Ensembl: ENSOCUG00000004870
UniProt: A0A5F9DB30
LinkDB
Position
14:86210312..86372017
AA seq 687 aa
MRLLWCVMSLYFYGIPQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYST
AHSAGLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTT
YCSKVAFPLEVVQKDSCFNSPMKLPVHRLYIEYGIQKITCPNVDGFFPSTVKPIITWYMG
CYKVQDFHNVIPEGMNLNFVIALVSNNGNYTCVVTYPENGRTFHLTRTVTVKVVGSPKDA
VPPQIHSPNDHVVYEKEPGEELLIPCEVYFTFLMDSRNEVWWTIDGKKPDDISIDVTINE
SLSYSKTEDETRTHVLSIKKVTPEDLKRNYVCHARNAKGEVDKAAKVKQKVVAPRYTVEL
ACGFGATVLLVVILIVVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEF
VLLTLRGVLENEFGYKLCIFDRDSLPGGNTVEAVFDFIQRSRRMIVVLSPDYVTEKSISM
LEFKLGVMCQNSIATKLIVVEYRPLEQPHPSILQLKESVSFVTWKGEKSKHSGSKFWKAL
RLALPLRSLSASSGWNESYSSQSDISLDHVQRRRSRLKEPPELQSSERAADAPPASDTVS
KHRGKPSAACRCCVTYCEGESHQKSKSRAEIHTQPQWETHLCKPVPQESETQWIQNGTRL
EPPVPQISALALHHFTDLSNNNDFYIL
NT seq 2064 nt   +upstreamnt  +downstreamnt
atgagacttctgtggtgtgtaatgagtctctacttctatgggatcccgcaaagtgatgcc
tcagaacgctgtgatgactggggactagataccatgaggcaaatccaagtttttgaagat
gagccagctcgcatcaagtgcccactttttgaacacttcttgaagtttaactacagcaca
gcgcattcggctggccttactttgatctggtattggactaggcaggaccgtgaccttgag
gagccaattaacttccgccttccggagaaccgcattagtaaggagaaagatgtgctctgg
ttccggcccaccctcctcaatgacacaggcaactatacctgcatgttaaggaataccaca
tattgcagcaaagttgcgtttcccctggaagttgttcaaaaagacagctgcttcaattcc
cccatgaaactcccagtgcatagattgtatatagaatatggtattcagaagatcacttgt
ccaaatgtagatggattttttccttccactgtcaaacccatcatcacttggtatatgggc
tgttataaagtgcaagattttcataacgtaataccagaaggcatgaacttgaattttgtc
attgctttggtttcaaataatggcaattacacgtgtgttgtcacatatcctgaaaatggg
cgtacctttcatctcaccaggactgtgactgtaaaggtggtaggctctccaaaagatgca
gttccccctcagatccattcgcccaatgatcatgtggtgtatgagaaagaaccaggagag
gagctactcatcccctgtgaagtctattttactttcctgatggactctcgcaatgaggtt
tggtggaccatcgatggaaaaaagcccgatgatatcagcattgatgtaaccattaatgaa
agtctaagttatagtaaaacagaagatgaaacaagaacacatgttttaagcatcaagaaa
gttactccagaggatctcaagcgcaactatgtctgtcatgctagaaatgccaaaggcgaa
gttgacaaagcagccaaggtgaaacagaaagtggtagctccaaggtacacagtagaactg
gcatgtggctttggagccacggtcctgctagtggtgattctcattgttgtttatcatgtt
tactggctggagatggtcctattttaccgagcccattttggaacagatgaaaccatttta
gatgggaaggagtatgatatttatgtatcctatgcaaggaatgctgaagaagaggaattt
gttttactgactctccgtggagttttagagaatgaatttggatataagttgtgcatcttt
gacagagacagccttcctgggggaaatacagtggaagcagtttttgatttcattcagagg
agccgaaggatgattgttgtcctgagtccagactatgtgacagaaaagagcatcagcatg
ctggagttcaaacttggtgtcatgtgccagaactccattgccacaaagctcattgtggtc
gagtatcgcccccttgagcagccacacccaagcatcttgcagctgaaggaatctgtttct
tttgtgacctggaagggagaaaagtccaaacattctggctccaaattctggaaagccttg
cggttggctcttcccctgagaagtctgagtgccagttctggctggaatgagagctactct
tcccagtctgacatcagtctggatcatgttcaaagaaggagaagtcgtttgaaagagccc
ccagaactgcagagctcagagagggctgcagatgctcctccagcctcagacacagtgtcc
aagcaccgagggaagccctctgcagcctgtcgctgctgtgtcacctactgtgaaggagaa
agccaccaaaagagcaagagtcgggcagagattcatacccagccccagtgggagacacac
ctttgtaagcctgttccccaagagtcagaaactcaatggatacaaaatggcaccagattg
gaaccccctgttccccagatctcagcccttgctcttcaccatttcacggatttatccaat
aacaatgacttttatatcctataa

DBGET integrated database retrieval system