KEGG   Oryctolagus cuniculus (rabbit): 100342358
Entry
100342358         CDS       T03373                                 
Symbol
PTK2B
Name
(RefSeq) protein tyrosine kinase 2 beta
  KO
K05871  focal adhesion kinase 2 [EC:2.7.10.2]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04020  Calcium signaling pathway
ocu04062  Chemokine signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04670  Leukocyte transendothelial migration
ocu04912  GnRH signaling pathway
ocu05135  Yersinia infection
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100342358 (PTK2B)
   04072 Phospholipase D signaling pathway
    100342358 (PTK2B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100342358 (PTK2B)
   04670 Leukocyte transendothelial migration
    100342358 (PTK2B)
   04062 Chemokine signaling pathway
    100342358 (PTK2B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100342358 (PTK2B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100342358 (PTK2B)
   05161 Hepatitis B
    100342358 (PTK2B)
   05163 Human cytomegalovirus infection
    100342358 (PTK2B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100342358 (PTK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100342358 (PTK2B)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100342358 (PTK2B)
Protein kinases [BR:ocu01001]
 Non-receptor tyrosine kinases
  FAK family
   100342358 (PTK2B)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT FERM_N_2 Pkinase FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 100342358
NCBI-ProteinID: XP_008247531
Ensembl: ENSOCUG00000007668
LinkDB
Position
2:complement(42273004..42400131)
AA seq 1010 aa
MSGVSEPLSRVKVGTLRRPEGPPEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIREIITSILLSGRIGPNIQLAECYGLRLKHMKSDEVHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPRQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFASIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDTKPTCLA
EFKQIKSIRCLPLEEGQAVLQLGIEGAPQCLSIKTSSPAEAENMADLIDGYCRLQGEHKG
SLIVHPKKDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDDTLRRSGGPQYGI
SREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKN
LDHPHIVKLMGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEEYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPILYTLMTR
CWDYDPSDRPRFTELVCSLSDIYQMEKDIALEQERNARYRPPKILEPTGFQEPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIRPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP
LTPEKEAGYTEFTAPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLDLKNELCQ
LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPASD
NT seq 3033 nt   +upstreamnt  +downstreamnt
atgtctggggtgtctgagcccctgagtcgagtaaaggtgggcacgttacgccggcctgaa
gggccgccagaacccatggtggtggtcccagtcgacgtggaaaaggaagacgtgcgtatc
ctcaaagtgtgcttctatagcaacagcttcaatcctgggaagaacttcaaactggtcaaa
tgcactgtacagaccgagatccgggagatcatcacctccatcctgctgagcgggcggatc
gggcccaacatccagctggctgagtgctatgggctgagactgaagcacatgaaatcagac
gaggtccactggctgcacccacagatgacggtgggtgaggtgcaggacaagtatgagtgt
ctacacgtggaagccgagtggaggtatgaccttcaaatccgctacctgccagaggacttc
atggagagcctgaaagaagacaggaccacgctgctgtatttttaccaacagctccggaat
gactacatgcaacgctatgccagcaaggtcagcgagggcatggccctgcagctgggctgc
ctggagctcaggcggttcttcaaggacatgccgcacaatgccctggacaagaagtccaac
ttcgagctcctggaaaaggaagtgggcctggacctgtttttccccaagcagatgcaggag
aatttaaagccccggcagttccggaagatgatccagcagacgttccagcagtacgcctcg
ctcagggaggaggagtgtgtcatgaagttcttcaacaccctggccggcttcgccagcatc
gaccaggagacctaccgctgtgaactcattcaagggtggaacattactgtggacctggtc
atcggccctaaaggcatccgccagctgacaagtcaggacacaaagcccacctgcctggct
gagttcaagcagatcaagtccatcagatgcctcccgctggaggagggccaggcggttctg
cagttgggcattgaaggtgccccccagtgcttgtccatcaaaacctcatctccagcagag
gctgagaacatggctgacctcatagatggctactgccggctgcagggggaacacaagggc
tccctcattgtccatcccaagaaagacggtgagaagcggaacagcctgccgcagatcccc
atgctaaacctggaagcccggcgctcccacctctccgaaagctgtagcatagagtctgac
atctacgcggagattccggatgacactctgcgaaggtcgggaggcccacagtacggcatc
agccgcgaagacgtggttctgaaccgtattctcggtgaaggcttctttggagaggtctat
gaaggggtctacaccaatcacaaaggggagaaaatcaacgtggctgtgaagacctgcaag
aaagactgcaccctggacaacaaggagaagttcatgagcgaggcagtgatcatgaagaac
ctcgaccacccgcacatcgtgaagttgatgggcatcatcgaggaggagcccacctggatc
atcatggagctgtacccctacggggagctgggccactacctggagcgaaacaagaactcc
ctgaaggtgctcaccctcgtcctgtactcgctgcagatatgcaaggcgatggcctacctg
gagagcatcaactgcgtgcacagggacatcgctgtccggaacatcctggtggcctcccct
gagtgtgtgaagctgggggactttggcctctctcggtacattgaggatgaggagtattac
aaagcctctgtgacgcgcctgcccatcaaatggatgtcccctgagtccatcaatttccgt
cgcttcacgacagccagcgatgtctggatgttcgccgtgtgcatgtgggagatcttgagc
tttgggaagcagcccttcttctggctggagaacaaggatgtcatcggggtgctcgagaaa
ggggaccggctgcccaaacctgacctctgcccacccatcctttacaccctcatgacccgc
tgctgggactatgaccccagtgaccggcctcgcttcaccgagcttgtgtgcagcctcagt
gacatttatcagatggagaaggacattgctctagagcaggagaggaacgctcgctaccga
cctcccaaaatcttggagcccacaggcttccaggaacccccaccaaagcccagccggccc
aagtatagaccccctccacaaaccaacctcctggctcccaagctgcagttccaggtcccc
gagggtctgtgtgccagctctcccacgctcaccagccctatggagtacccatctcctgtt
aactcgctgcacaccccgcctctgcaccggcacaatgtcttcaagcgccacagcatgcgg
gaggaggacttcatccgacccagcagccgagaagaggcccagcagctgtgggaggctgag
aaggtcaagatgcggcagatcctggacaagcagcagaagcagatggtggaagactaccag
tggctgaggcaggaggagaagtccttggaccccatggtctacatgaacgataagtcccca
ctgaccccagagaaggaggccggttacacggagttcacagcacccccacagaagcccccg
cggctgggtgcgcagtccatccagcccacagccaacctggaccggactgatgacttggtg
tacctcaatgtcatggagctggttcgggccgtgctggacctcaagaacgagctgtgccag
ctgccccccgagggctacgtggtggtggtgaagaacgtgggactgaccctgcggaagctc
atcgggagtgtggacgacctcctgccctccttgccgtcatcctcgcggacagagatcgaa
gggacccagaagctgctcaacaaagacctggcggagctcatcaacaagatgcggctggcc
cagcagaacgccgtgacctccctgagtgaggagtgcaagcgccagatgctcacggcttcc
cacaccttggccgtggacgccaagaacctgctcgatgccgtggaccaggccaaggttctg
gccaacctagcccatccgcctgcaagtgactga

DBGET integrated database retrieval system