KEGG   Oryctolagus cuniculus (rabbit): 100342681
Entry
100342681         CDS       T03373                                 
Symbol
ANAPC15
Name
(RefSeq) anaphase promoting complex subunit 15
  KO
K25228  anaphase-promoting complex subunit 15
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100342681 (ANAPC15)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100342681 (ANAPC15)
   04114 Oocyte meiosis
    100342681 (ANAPC15)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100342681 (ANAPC15)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100342681 (ANAPC15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100342681 (ANAPC15)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100342681 (ANAPC15)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100342681 (ANAPC15)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100342681 (ANAPC15)
SSDB
Motif
Pfam: ANAPC15 RNA_pol_Rpc4 DUF2457 V_ATPase_I
Other DBs
NCBI-GeneID: 100342681
NCBI-ProteinID: XP_002708765
LinkDB
Position
1:144244472..144248591
AA seq 121 aa
MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASE
HYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWM
I
NT seq 366 nt   +upstreamnt  +downstreamnt
atgtccaccttgttcccttccctcttccctcgtgtgactgagacactgtggtttaatctg
gatcgaccctgtgtggaggagacagagctgcagcagcaggaacagcagcatcaggcgtgg
ctccaaagcattgcagagaaagacaacaatctggtacctatcggcaagccagcctcagag
cactatgatgatgaggaagaagaagatgatgaagacgatgaggacagtgaagaagactca
gaggatgatgaggacatgcaggacatggacgagatgaatgactacaacgagtcacctgat
gatggagaggtcaatgaggtggacatggaaggcaacgaacaggatcaggaccagtggatg
atctag

DBGET integrated database retrieval system