Oryctolagus cuniculus (rabbit): 100342931 Help Entry 100342931         CDS       T03373                                  Symbol IFNB1 Name (RefSeq) interferon beta 1   KO K05415   interferon beta Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04151   PI3K-Akt signaling pathway ocu04217   Necroptosis ocu04380   Osteoclast differentiation ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04623   Cytosolic DNA-sensing pathway ocu04630   JAK-STAT signaling pathway ocu04650   Natural killer cell mediated cytotoxicity ocu04668   TNF signaling pathway ocu04936   Alcoholic liver disease ocu05135   Yersinia infection ocu05142   Chagas disease ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05165   Human papillomavirus infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100342931 (IFNB1)    04668 TNF signaling pathway     100342931 (IFNB1)    04151 PI3K-Akt signaling pathway     100342931 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100342931 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100342931 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100342931 (IFNB1)    04621 NOD-like receptor signaling pathway     100342931 (IFNB1)    04622 RIG-I-like receptor signaling pathway     100342931 (IFNB1)    04623 Cytosolic DNA-sensing pathway     100342931 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     100342931 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     100342931 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100342931 (IFNB1)    05161 Hepatitis B     100342931 (IFNB1)    05160 Hepatitis C     100342931 (IFNB1)    05171 Coronavirus disease - COVID-19     100342931 (IFNB1)    05164 Influenza A     100342931 (IFNB1)    05162 Measles     100342931 (IFNB1)    05168 Herpes simplex virus 1 infection     100342931 (IFNB1)    05163 Human cytomegalovirus infection     100342931 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     100342931 (IFNB1)    05169 Epstein-Barr virus infection     100342931 (IFNB1)    05165 Human papillomavirus infection     100342931 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     100342931 (IFNB1)    05152 Tuberculosis     100342931 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     100342931 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100342931 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100342931 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:ocu04052]     100342931 (IFNB1) Cytokines and growth factors [BR:ocu04052]  Cytokines   Interferons    100342931 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Forkhead Motif Other DBs NCBI-GeneID:  100342931 NCBI-ProteinID:  XP_002708014 Ensembl:  ENSOCUG00000021649 UniProt:  G1TTX4 LinkDB All DBs Position 1:32645865..32646407 Genome browser AA seq 180 aa AA seqDB search MINRCILQIALLLCFSTTALSMSYNSLQIQLWHGSLTCAKLLLQLNGTTEDCLNERINFK VPKEIKEPQQLQKEDTTLVIFEMLNNIFDIFRKNFSSTGWNETLVENLLGETHLQIHHLK SKINKKVTLESIRMNLRLKSYYWRIMDYLETKQYSNCAWKIVQLEIFRNFSFIIMLIDYL NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atgatcaacaggtgtatccttcaaatcgctctcctgttgtgcttctccaccacagctcta tccatgagctacaactcgcttcagatccaactatggcacggaagtctgacgtgtgcgaag ctcctgctccagttgaatggaacgactgaggactgcctcaatgagaggataaacttcaaa gtccccaaggagattaaggaaccacaacagctccagaaagaagacaccaccttggttatc tttgaaatgctcaacaacatctttgacattttcagaaaaaatttctctagcactggctgg aatgagacccttgttgagaaccttcttggtgaaacccatttgcagattcatcatctgaag agcaaaataaacaaaaaggtaaccttggagagcatcagaatgaatctacgcctgaagagc tattactggaggatcatggattatctggagaccaagcagtatagcaactgtgcctggaaa atagtccagttggaaatcttcaggaacttttcctttatcatcatgctcatagattacctc taa

DBGET integrated database retrieval system