KEGG   Oryctolagus cuniculus (rabbit): 100342931
Entry
100342931         CDS       T03373                                 
Symbol
IFNB1
Name
(RefSeq) interferon beta 1
  KO
K05415  interferon beta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04380  Osteoclast differentiation
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04668  TNF signaling pathway
ocu04936  Alcoholic liver disease
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100342931 (IFNB1)
   04668 TNF signaling pathway
    100342931 (IFNB1)
   04151 PI3K-Akt signaling pathway
    100342931 (IFNB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100342931 (IFNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100342931 (IFNB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100342931 (IFNB1)
   04621 NOD-like receptor signaling pathway
    100342931 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    100342931 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    100342931 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    100342931 (IFNB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100342931 (IFNB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100342931 (IFNB1)
   05161 Hepatitis B
    100342931 (IFNB1)
   05160 Hepatitis C
    100342931 (IFNB1)
   05171 Coronavirus disease - COVID-19
    100342931 (IFNB1)
   05164 Influenza A
    100342931 (IFNB1)
   05162 Measles
    100342931 (IFNB1)
   05168 Herpes simplex virus 1 infection
    100342931 (IFNB1)
   05163 Human cytomegalovirus infection
    100342931 (IFNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100342931 (IFNB1)
   05169 Epstein-Barr virus infection
    100342931 (IFNB1)
   05165 Human papillomavirus infection
    100342931 (IFNB1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100342931 (IFNB1)
   05152 Tuberculosis
    100342931 (IFNB1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100342931 (IFNB1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100342931 (IFNB1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100342931 (IFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100342931 (IFNB1)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100342931 (IFNB1)
SSDB
Motif
Pfam: Interferon Forkhead
Other DBs
NCBI-GeneID: 100342931
NCBI-ProteinID: XP_002708014
Ensembl: ENSOCUG00000021649
UniProt: G1TTX4
LinkDB
Position
1:32645865..32646407
AA seq 180 aa
MINRCILQIALLLCFSTTALSMSYNSLQIQLWHGSLTCAKLLLQLNGTTEDCLNERINFK
VPKEIKEPQQLQKEDTTLVIFEMLNNIFDIFRKNFSSTGWNETLVENLLGETHLQIHHLK
SKINKKVTLESIRMNLRLKSYYWRIMDYLETKQYSNCAWKIVQLEIFRNFSFIIMLIDYL
NT seq 543 nt   +upstreamnt  +downstreamnt
atgatcaacaggtgtatccttcaaatcgctctcctgttgtgcttctccaccacagctcta
tccatgagctacaactcgcttcagatccaactatggcacggaagtctgacgtgtgcgaag
ctcctgctccagttgaatggaacgactgaggactgcctcaatgagaggataaacttcaaa
gtccccaaggagattaaggaaccacaacagctccagaaagaagacaccaccttggttatc
tttgaaatgctcaacaacatctttgacattttcagaaaaaatttctctagcactggctgg
aatgagacccttgttgagaaccttcttggtgaaacccatttgcagattcatcatctgaag
agcaaaataaacaaaaaggtaaccttggagagcatcagaatgaatctacgcctgaagagc
tattactggaggatcatggattatctggagaccaagcagtatagcaactgtgcctggaaa
atagtccagttggaaatcttcaggaacttttcctttatcatcatgctcatagattacctc
taa

DBGET integrated database retrieval system