KEGG   Oryctolagus cuniculus (rabbit): 100343190
Entry
100343190         CDS       T03373                                 
Symbol
TRAF6
Name
(RefSeq) TNF receptor associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04140  Autophagy - animal
ocu04144  Endocytosis
ocu04380  Osteoclast differentiation
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04722  Neurotrophin signaling pathway
ocu04936  Alcoholic liver disease
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05222  Small cell lung cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100343190 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100343190 (TRAF6)
   04064 NF-kappa B signaling pathway
    100343190 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100343190 (TRAF6)
   04140 Autophagy - animal
    100343190 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100343190 (TRAF6)
   04621 NOD-like receptor signaling pathway
    100343190 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    100343190 (TRAF6)
   04657 IL-17 signaling pathway
    100343190 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100343190 (TRAF6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100343190 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100343190 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100343190 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100343190 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100343190 (TRAF6)
   05161 Hepatitis B
    100343190 (TRAF6)
   05160 Hepatitis C
    100343190 (TRAF6)
   05171 Coronavirus disease - COVID-19
    100343190 (TRAF6)
   05162 Measles
    100343190 (TRAF6)
   05168 Herpes simplex virus 1 infection
    100343190 (TRAF6)
   05169 Epstein-Barr virus infection
    100343190 (TRAF6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100343190 (TRAF6)
   05135 Yersinia infection
    100343190 (TRAF6)
   05133 Pertussis
    100343190 (TRAF6)
   05152 Tuberculosis
    100343190 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100343190 (TRAF6)
   05140 Leishmaniasis
    100343190 (TRAF6)
   05142 Chagas disease
    100343190 (TRAF6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100343190 (TRAF6)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100343190 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100343190 (TRAF6)
   04121 Ubiquitin system [BR:ocu04121]
    100343190 (TRAF6)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100343190 (TRAF6)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100343190 (TRAF6)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    100343190 (TRAF6)
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-RING_5 zf-TRAF_2 Tropomyosin_1 SlyX EzrA UPF0242 U-box Med21 Spc29 DUF3450 DUF4455 DUF16 Sina PspA_IM30
Other DBs
NCBI-GeneID: 100343190
NCBI-ProteinID: XP_002709100
Ensembl: ENSOCUG00000012011
LinkDB
Position
1:complement(175766764..175788216)
AA seq 540 aa
MSLLNCENSCGSGQSESDCCAAMASSCSAAAKDDSVSGTASTGNLSGSFVEDIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLTVKCPNEGCLHKMELRHLEDHQAHCGFALVNCPQCQRPFQKCQINTHILK
DCPRRQVSCINCAVSMAFEDKEIHDQNCPLANVICEYCNTMLIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARHLQEKTQLHMRMLAQAVHSLNLALTPIPPRDVPQYDVPSQ
PRVPSGYPEGHNFQETIQQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVA
EIEAQQCNGIYIWKIGNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQR
CANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPIRQNHEEIMDAKPELLAFQRP
TIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgagtctgctaaactgtgaaaacagctgtggatctggccagtctgaaagtgactgctgt
gcggccatggccagctcatgcagtgctgcagccaaagatgacagtgtgagtgggactgcc
agcacggggaacctttctggctcgtttgtggaagacatccagggatatgatgtggagttc
gacccacccctggaaagcaagtatgaatgccccatctgcttaatggcgttacgggaagca
gtgcagaccccatgcggccataggttctgcaaagcctgcatcatcaaatcaataagggat
gcaggccacaaatgtccagttgacaatgaaatactattggaaaatcagctatttcctgac
aattttgcaaagcgagagattctttctctgacagtgaagtgtccaaatgaaggttgtttg
cacaagatggaactgaggcatcttgaggatcatcaagcacattgtgggtttgctcttgtg
aattgtcctcagtgccaacgtcctttccagaaatgccaaattaatactcacatcctcaag
gattgtccaaggagacaagtttcttgtataaactgtgcggtatccatggcatttgaagat
aaagagatccatgaccagaactgtcctttggcaaatgtcatttgtgaatactgcaatacc
atgctcatcagagaacagatgcctaatcattatgatctagactgccctaccgctccaatt
ccatgtacattcagtacttttggctgccatgaaaagatgcagaggaatcacttggcacgc
cacctacaagagaaaacccagttgcacatgagaatgttggcccaggctgttcatagtttg
aaccttgctttaactcccatacctccacgtgatgtgcctcagtacgatgttccttctcag
ccccgggttccctccgggtatccagagggccacaacttccaggaaactattcagcagtta
gagggtcgccttgtaagacaagaccatcaaattagggagctgactgcaaaaatggaaact
cagagcatgtacgtaagtgagctcaaaagaactattcgaacccttgaggacaaagttgct
gaaattgaagcacagcagtgtaatggaatttacatctggaagatcggcaactttgggatg
catttaaaatctcaagaagaggagaaacctgttgttattcacagccctggattctacacg
ggcaaacccggatacaaactctgcatgcgcttgcaccttcagttaccaactgctcagcgc
tgtgcaaactatatatccctctttgtgcatacaatgcaaggagagtatgacagccacctt
ccttggcccttccagggtacaatacgccttacaattcttgatcagtctgaagcacccata
aggcaaaaccatgaagagataatggatgccaaaccagagttacttgccttccagcggccc
acaattccacggaacccaaaaggttttggctatgtaacttttatgcaccttgaagcctta
cgacaaagaacctttataaaggatgatacgttattagtgcgctgtgaagtctctacccgc
tttgacatgggtagccttcggagggagggttttcagcctcgaagtactgatgcaggggta
tag

DBGET integrated database retrieval system