KEGG   Oryctolagus cuniculus (rabbit): 100343726
Entry
100343726         CDS       T03373                                 
Symbol
IL7R
Name
(RefSeq) interleukin 7 receptor
  KO
K05072  interleukin 7 receptor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04068  FoxO signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04640  Hematopoietic cell lineage
ocu05200  Pathways in cancer
ocu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100343726 (IL7R)
   04068 FoxO signaling pathway
    100343726 (IL7R)
   04151 PI3K-Akt signaling pathway
    100343726 (IL7R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100343726 (IL7R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100343726 (IL7R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100343726 (IL7R)
  09163 Immune disease
   05340 Primary immunodeficiency
    100343726 (IL7R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100343726 (IL7R)
   04090 CD molecules [BR:ocu04090]
    100343726 (IL7R)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL2 receptor family
   100343726 (IL7R)
CD molecules [BR:ocu04090]
 Proteins
  100343726 (IL7R)
SSDB
Motif
Pfam: FN3_7 fn3 bMG1
Other DBs
NCBI-GeneID: 100343726
NCBI-ProteinID: XP_002714181
Ensembl: ENSOCUG00000011402
UniProt: G1T184
LinkDB
Position
11:57148921..57177890
AA seq 458 aa
MTILGTALGLAFYLLQAVSGESGYAQNGDLEDAEVDEYSFSCYSQLEVDGFQHSLTCAFD
DPDANSTNLEFEICGALLRVKCLNFSKLQELYFIKTKNFLLIGDSKICVKLGKKNLICKE
IDITKIVKPEPPFDIKATYRKGANDFMVTFNTSHLQKQYVNQLIHDVAYRQEKDEGNWMH
VNLSSTKLTLLQRKLQPDAMYEIRVRSIPNSNYFEGFWSDWSPSTHFRTPENHRAGEIDP
VLLTVSILSFCSVVLLAILACVLWKKRIKPMIWPSIPDHKKTLEQLCKKPKKNLNVSFNP
ESFLDCQIHEVDGIQARDEVEGFLQDIFPPQPEKSEKQKCGAGAQGSSCPSNVTIITPET
FRESPPRFLTENFSACDSPVLLSFRSQNGRESGQGGSHVYHGLLLSPGTTNSTPIPPFPP
QSGILTLNPVAQGQPILTSLGPGQEEAYVSMSSFYQNQ
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgacaattctaggtacagctcttggtttggctttctatttacttcaagctgtttctgga
gaaagtggctatgcacagaatggagacttggaagatgccgaagtggatgaatattcattc
tcatgctacagtcagctggaagtggatggatttcagcactcattgacctgtgcttttgat
gacccagatgccaacagcaccaatctggaatttgaaatatgtggtgctcttttgagggta
aaatgcctgaattttagtaaactacaagagctgtatttcatcaagacaaaaaacttctta
cttattggagacagcaaaatatgtgtaaagcttggaaaaaagaatctaatttgcaaagaa
attgacattaccaagatagttaaacctgaacctccgtttgacataaaagctacctatcgt
aagggagcaaatgactttatggtgacatttaatacatcgcacttgcaaaagcagtatgta
aatcaattaatacatgatgtagcctaccgccaggaaaaagatgaaggcaactggatgcat
gtgaatttatccagcacaaagctgacactcctgcagagaaagctacaacctgatgcgatg
tatgagattcgagtccgatccatccctaatagcaactattttgaaggcttctggagcgat
tggagcccaagtactcatttcagaacaccagagaaccatagggcaggggagatagatcct
gtcctcctaactgtcagcattctgagtttctgctctgtggttcttttggctatcttggcc
tgtgtattatggaaaaaaaggattaagcctatgatatggcccagtatccctgatcataag
aaaactctggaacaactctgtaagaaaccaaaaaagaatttgaatgtgagcttcaatccg
gaaagtttcctggactgtcagattcatgaggtggatggcattcaagctagagatgaagtg
gaaggcttcctgcaagatattttccctccacagccagagaagtctgagaagcagaaatgt
ggagcaggagctcaaggctccagctgcccatccaatgttacaatcatcaccccagaaact
ttcagagagtcaccccccagattcctaactgagaatttcagtgcatgtgattcccctgta
ctgctctctttcaggtcccaaaatggcagagagagtggccaaggtgggtctcatgtatac
catggcctcctgcttagtcctggtactacaaacagcacaccaatccctccatttcctccc
caatcaggaatcctgacattgaacccagttgcccaaggacagcccatcctcacttccctg
ggaccaggtcaagaagaagcatatgtctccatgtccagcttctaccaaaaccagtga

DBGET integrated database retrieval system