KEGG   Oryctolagus cuniculus (rabbit): 100343893
Entry
100343893         CDS       T03373                                 
Symbol
STAT1
Name
(RefSeq) signal transducer and activator of transcription 1
  KO
K11220  signal transducer and activator of transcription 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04062  Chemokine signaling pathway
ocu04217  Necroptosis
ocu04380  Osteoclast differentiation
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04917  Prolactin signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu05140  Leishmaniasis
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05212  Pancreatic cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100343893 (STAT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100343893 (STAT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100343893 (STAT1)
   04621 NOD-like receptor signaling pathway
    100343893 (STAT1)
   04625 C-type lectin receptor signaling pathway
    100343893 (STAT1)
   04658 Th1 and Th2 cell differentiation
    100343893 (STAT1)
   04659 Th17 cell differentiation
    100343893 (STAT1)
   04062 Chemokine signaling pathway
    100343893 (STAT1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100343893 (STAT1)
   04935 Growth hormone synthesis, secretion and action
    100343893 (STAT1)
   04919 Thyroid hormone signaling pathway
    100343893 (STAT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100343893 (STAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100343893 (STAT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100343893 (STAT1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100343893 (STAT1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100343893 (STAT1)
   05160 Hepatitis C
    100343893 (STAT1)
   05171 Coronavirus disease - COVID-19
    100343893 (STAT1)
   05164 Influenza A
    100343893 (STAT1)
   05162 Measles
    100343893 (STAT1)
   05168 Herpes simplex virus 1 infection
    100343893 (STAT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100343893 (STAT1)
   05169 Epstein-Barr virus infection
    100343893 (STAT1)
   05165 Human papillomavirus infection
    100343893 (STAT1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100343893 (STAT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100343893 (STAT1)
   05140 Leishmaniasis
    100343893 (STAT1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100343893 (STAT1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100343893 (STAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100343893 (STAT1)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100343893 (STAT1)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 NPV_P10 TRPM_tetra Syntaxin-6_N
Other DBs
NCBI-GeneID: 100343893
NCBI-ProteinID: XP_002712392
Ensembl: ENSOCUG00000002455
UniProt: G1SHL8
LinkDB
Position
7:complement(131407377..131451503)
AA seq 750 aa
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLENQDWEHAANDVSFATILFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYNCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDNKVRNVKEQVMNIEHEIKTLEDLQDEYDFKCKTLQNR
EHEANGVAKSDQKQEQLLLQKMYLMLDNKRKEIVHKMRELLNATELTQNALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKFTYEHDPITKNKQV
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGNRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPLVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLNPPCARWSQLSEVLSWQFSSVTKRGLNGDQLSMLGEKLLGPNAGLDGLIPWT
RFCKENISDKNFSFWLWIENILELIKKHLLCLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPYFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEGQEPMELDGPKGTGYIKTELISVSEVHPSRLQST
ENLLPMSPEEFDEVSRIMGPVEFDSMMNAV
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgtctcagtggtatgagcttcagcagctcgactctaaattcctggagcaggttcaccag
ctctatgatgacagttttcccatggaaattcgacagtacctggcacagtggctagaaaat
caggactgggagcacgccgccaatgatgtttcgtttgccaccatcctcttccatgacctg
ctctcgcagctggacgatcagtacagtcgcttctctctggagaacaattttctgttgcag
cataacataaggaaaagcaagcggaaccttcaggacaattttcaagaagaccccatacag
atgtctatgatcatctataactgtctgaaggaggagcggaagattctggaaaatgcgcag
agattcaatcaggcccagtcggggaatattcagagcaccgtgatgttagacaagcagaag
gagcttgacaacaaagtcagaaatgtgaaggagcaagtgatgaatatagagcacgaaatc
aagaccctggaagatctacaagatgagtatgacttcaagtgcaaaaccttgcagaaccga
gaacatgaagccaatggtgtggcaaagagcgaccagaagcaagagcagctgctgctccag
aagatgtatttaatgctggacaacaagaggaaggaaatcgttcacaagatgagagagttg
ttgaatgccactgagctcacccagaatgccctgattaacgatgagctcgtggagtggaag
cggaggcagcagagcgcctgtatcgggggcccgcccaacgcgtgcctggaccagctgcag
aactggttcaccatagtggcagagagtctgcagcaggttcgtcagcagcttaaaaagctg
gaggaattggaacagaaattcacctatgaacatgaccctatcaccaagaacaaacaggtg
ctatgggatcgcaccttcagtctcttccagcagctcattcagagctcgttcgtggtggag
agacagccttgcatgcccactcatcctcagagaccgctggtcttgaagactggggtgcag
ttcactgtgaagctgaggctgttggtgaaactgcaagagctgaattataacttgaaagtc
aaagtcctgtttgacaaagacgtgaatgagagaaacacagtgaaaggattcaggaagttc
aacatcctgggcacacacacgaaggtgatgaacatggaggagtccaccaacggaagtctg
gcggcggaattccgacacctgcaactgaaagaacagaagaacgctggcaacaggactaac
gagggtcctctaattgtaaccgaagagcttcactccctaagttttgaaacccagctgtgc
cagcctggcctggtcattgacctcgagacgacttccctgcccctcgtggtgatctccaac
gtcagccagctcccgagcggttgggcgtccatcctgtggtacaacatgctggtggcggag
cctaggaatctgtccttcttcctgaacccaccgtgtgcgcgatggtctcagctctcggag
gtactgagttggcagttttcctctgtcaccaaacgcggcctcaacggggaccagctgagc
atgctgggagagaagctacttggtcctaatgccggcctcgatggtcttattccgtggacg
aggttctgcaaggaaaatataagtgacaaaaatttctccttctggctgtggattgaaaac
atcctagaactgattaaaaagcacctgctgtgtctatggaatgatgggtgcatcatgggc
ttcatcagcaaggagcgagagcgcgccctgctgaaggaccagcagcccggcacgttcctg
ctgcggttcagcgagagcagccgggaaggcgccatcacgttcacgtgggtggagcggtcc
cagaacggaggcgaaccttatttccatgcggttgagccctacacgaagaaagaactttct
gctgtgactttccctgatatcatccgcaattacaaagtcatggctgccgagaatattcct
gagaaccccctgaagtatctgtatccaaatattgacaaggaccatgccttcgggaagtat
tactccaggccaaaggaagggcaagaacccatggaacttgacggccccaaaggaactgga
tacatcaagactgagttgatttctgtgtctgaagttcacccttctagactccagagcaca
gaaaacctgctgcccatgtctcctgaggagtttgatgaggtgtctcggataatgggccct
gtagaattcgacagtatgatgaacgcagtatag

KEGG   Oryctolagus cuniculus (rabbit): 100344146
Entry
100344146         CDS       T03373                                 
Symbol
STAT4
Name
(RefSeq) signal transducer and activator of transcription 4
  KO
K11222  signal transducer and activator of transcription 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04217  Necroptosis
ocu04630  JAK-STAT signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu05161  Hepatitis B
ocu05200  Pathways in cancer
ocu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100344146 (STAT4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100344146 (STAT4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100344146 (STAT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100344146 (STAT4)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100344146 (STAT4)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100344146 (STAT4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100344146 (STAT4)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100344146 (STAT4)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 NPV_P10
Other DBs
NCBI-GeneID: 100344146
NCBI-ProteinID: XP_008257064
Ensembl: ENSOCUG00000002466
UniProt: G1SHM5
LinkDB
Position
7:complement(131467545..131617753)
AA seq 748 aa
MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNL
LIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAAN
MPVQGPLEKSLQSSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQT
MDQGDKNSALMNQEVLTLQEMLNSLDFKRKEALSKMTQIVNETDLLMNSMLIEELQDWKR
RQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPVPIQRTHL
QERVTFLIYNLFKNSFVVERQPCMPTHPQRPMVLKTLIQFTVKLRLLIKLPELNYQVKVK
ASIDKNISTLSNRRFVLCGTHVKAMSIEESSNGSLSVEFRHLQPKEMKSSAGSKGNEGCH
MVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNL
VFFNNPPSATLSQLLEVMSWQFSSYVGRGLNSDQLNMLAEKLTVQSSYSDGHLTWAKFCK
EHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYIMGFVSKEKERLLLKDKMPGTFLLRFS
ESHLGGITFTWVDHSENGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKY
LYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPQSPSDLLPM
SPSVYAVLRENLSPTTIETAMKSPYSAE
NT seq 2247 nt   +upstreamnt  +downstreamnt
atgtctcagtggaatcaagtccaacagctagaaatcaagtttttggaacaagtagatcaa
ttctacgatgacaactttcctatggaaattcgacatctgctggcccagtggattgaaaac
caagactgggaggcggcatctaacaatgaaaccatggcaacaattcttctccaaaacttg
ctaatacaattggatgaacagttaggccgtgtttccaaagagaaaaacctactcttgata
cacaatctgaaaagaattaggaaagtccttcagggaaaatttcatggcaatccaatgcat
gtagctgtagttatttcaaattgtctaagggaagaaaggagaatattggctgcagccaac
atgccggtccagggacctctggagaaatctttacaaagttcttcagtttcagaaagacag
cgaaatgtggagcacaaagtggctgccattaaaaacagtgtgcagatgacagaacaagac
accaaatacttagaagatctgcaagatgaatttgactacagatacaaaacgattcagaca
atggatcagggtgacaagaacagtgccctgatgaatcaggaagttttgacactgcaagaa
atgcttaacagccttgacttcaagagaaaggaagccctcagtaagatgacgcaaatcgtg
aatgaaacagacttgctgatgaacagcatgctcatcgaggagctgcaggactggaagcgg
aggcagcagatcgcctgcatcggagggccgctccacaatgggctcgaccagcttcaaaac
tgctttacactattggcggaaagtcttttccaactcagaaggcaattggagaaattagaa
gagcaatctaccaaaatgacgtatgaaggtgatcccgtcccgatacaaaggacacacctg
caagaaagagtcaccttcttgatctacaacctttttaagaactcatttgtggttgagaga
cagccatgtatgccgacccaccctcagaggccgatggtgctgaaaaccctcattcagttc
actgtgaaactaagactactaataaaattgccagaactaaactatcaggtaaaggtgaaa
gcatcaattgacaagaatatttcaactctaagcaatcgaagatttgtcctctgtggaact
cacgtcaaagccatgtccattgaagaatcttccaatgggagtctgtctgtagaatttcga
catttgcaaccaaaggaaatgaagtccagtgctggaagtaaaggaaatgagggctgtcac
atggtgactgaagagcttcattccataacatttgagacacagatttgcctgtatggcctg
accatagatttggagaccagctcattacctgtggtgatgatttccaatgtcagtcagtta
cctaatgcttgggcatccatcatttggtacaatgtgtcaactaacgattcccagaacttg
gttttctttaataatcctccgtctgccactctgagtcaactcctggaagtgatgagctgg
cagttttcatcctatgttggccgtggccttaactcagatcaactcaatatgctggccgag
aaactcacagttcagtccagctacagtgatggtcacctcacctgggcaaagttctgcaag
gaacacttacctggcaaatcatttaccttctggacatggcttgaggcgatcctagatcta
attaagaagcacattcttcccctgtggattgatgggtacatcatgggctttgttagcaaa
gagaaggaacggctcttgctgaaggataaaatgcctggaaccttcttattaagattcagt
gaaagccatcttggaggaataactttcacctgggtggaccattctgaaaatggagaagtg
agattccactctgtagaaccttacaataaaggccggttgtctgctctgccgtttgctgac
atccttcgagactacaaggttattatggctgaaaacattcctgaaaaccctctgaagtac
ctgtatccagatattcccaaagataaagccttcggtaaacactacagctcccagccttgc
gaagtgtcaaggccaactgagaggggagacaaaggatatgttccttcagtttttattccc
atttcaacaatccgaagtgattcgactgagccacagtccccgtcggacctcctccccatg
tctccaagtgtatatgcagtgctgagggaaaacctgagtcccacaacaattgaaactgca
atgaagtctccatattctgctgaatga

KEGG   Oryctolagus cuniculus (rabbit): 100344264
Entry
100344264         CDS       T03373                                 
Symbol
STAT6
Name
(RefSeq) signal transducer and activator of transcription 6
  KO
K11225  signal transducer and activator of transcription 6
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04217  Necroptosis
ocu04630  JAK-STAT signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu05161  Hepatitis B
ocu05200  Pathways in cancer
ocu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100344264 (STAT6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100344264 (STAT6)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100344264 (STAT6)
   04659 Th17 cell differentiation
    100344264 (STAT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100344264 (STAT6)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100344264 (STAT6)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100344264 (STAT6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100344264 (STAT6)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100344264 (STAT6)
SSDB
Motif
Pfam: STAT6_C STAT_bind STAT_int STAT_alpha SH2
Other DBs
NCBI-GeneID: 100344264
NCBI-ProteinID: XP_002720983
Ensembl: ENSOCUG00000007929
UniProt: G1SU42
LinkDB
Position
Un
AA seq 842 aa
MSLWGLVSKMPPEKLQRLYVDFPPHLRHLLGDWLETQPWEFLVGSDAFCLSMASALFSAT
VKRLQTSAGEQGEGSAILQPISTLESVYQRDPLKLVAIFRQILQGEKKAVMEQFHHLPMP
FHWKQEELKFSTALQRLRHRVEEAHRLRDALQQGPEAGQVSLHSLLETPANGTGPNEALA
TLLQVAVGELEAAQALVLKRIQIWKRQQQLSGNGAPFEESLAPLQERCESLVDIYSQLQQ
EVGAAGAELEPKTRAPLISRLDEVLHTLVTSSFLVEKQPPQVLKTQTKFQAGVRFLLGLR
FLGASAKPPLVRAEMVTEKQARELSVPQGPGTSAESTGEILNNTASLENSIPGNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSTSFTLGPGKVPVQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQK
IFNDNSLNVEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIVG
FISKQYVTSLLLGEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPE
PQMPAMMPSYDLGMPLESAMQLGPDVSQVYPPPAHSIPYQGLPTEDSVGVLSAFPETRLQ
ISPSLSQMNLPFVQPHPSLLQCQPQEHAVSSPKPPLCSDVTMAEDSCLGQQVAGFPQNTW
PSEDMFPPLMPPTEQDLTKLLLEGQGEAGGGSLGPQPLLQPSHYGQTGISMSHLDLRANP
SW
NT seq 2529 nt   +upstreamnt  +downstreamnt
atgtctctgtggggtctggtctccaagatgcccccagagaaactgcagcgactctacgtc
gacttccccccacacttgcggcatctcctgggagactggctggagacccagccctgggag
ttcctggtcggctcggacgccttctgcctctccatggctagcgctctcttttcagccacg
gtcaagcgcctccagacctcagcgggagagcaaggcgaggggagcgccatcttgcaaccc
atcagcaccctggagagtgtatatcagagggaccccctgaagctggtggccattttcaga
caaattcttcaaggggagaaaaaagctgttatggaacagttccaccacctgccaatgccc
ttccactggaagcaggaagagctcaagttcagcacagccctgcagaggctgcggcaccga
gtggaggaggcccaccgtctccgggacgccctgcagcaggggcctgaggccggccaagtg
tctttgcacagcttgctggaaactcctgccaatgggacaggcccaaatgaggcgctggcc
acgctgctgcaggtggccgtgggggagctggaggcagcccaggccttggtgctgaagagg
atccagatctggaagcggcagcaacagctgtcagggaatggcgcaccctttgaggagagc
ctggccccgctgcaggagaggtgtgagagcctggtggacatttattcccagctacagcag
gaggtaggggcggctggtgcggagctggagcccaagacccgggccccgctgatcagccgg
ctggatgaagtcctgcacaccctggtcaccagctccttcctggtggagaagcagcccccc
caggttctgaagacccagaccaagttccaggcaggggtccgattcctgctgggcctgcgg
ttcctgggggcctcagccaagcctccgctggtcagggctgagatggtgaccgagaagcag
gcgagggagctgagtgtgccccagggacctggcacttctgcagagagcacaggagaaatt
ctcaacaacaccgcgtccctggagaacagcattcctgggaactgctgctccgccctcttc
aagaacctgcttctgaagaaaatcaagcggtgtgagcggaagggcaccgagtcggtcact
gaggagaagtgtgctgtgctcttttccaccagcttcacgctgggccctggcaaagtcccc
gtccagctccaggccctgtctctgcccttggtggtcatcgttcatggtaaccaagacaac
aacgccaaagccaccatcctgtgggacaatgccttctcggagatggaccgtgtgcctttt
gtggtggctgagcgtgtgccctgggagaagatgtgtgaaactctgaacctcaagttcatg
gccgaggtggggaccaaccgggggctgctcccagagcacttcctcttcctggcccagaag
atcttcaatgacaacagcctcaacgtggaggctttccagcaccgctctgtgtcctggtca
cagttcaacaaggagatcctgctgggccgaggcttcaccttctggcagtggttcgatggc
gtcctggacctcaccaaacgctgcctcaggagctactggtccgaccggctgatcgttggc
ttcatcagcaagcagtatgtcacgagccttctcctcggtgagcctgacggaaccttcctc
ctccgcttcagcgactcagagattgggggcatcaccatcgcccacgtcatccggggccag
gatggctccccacagatagagaacattcagccattctcagccaaagacctctccattcgc
tccctgggggaccggatccgggacctcgctcagctcaaaaacctctaccccaagaagccc
aaggatgaggctttccggagccactacaagcctgaacagatgggaaaggacggcaggggt
tacgtcccagctaccatcaagatgaccgtggaaagggaccagcctcttcccaccccggag
ccccagatgcctgccatgatgccctcttatgaccttgggatgcccctggagtctgccatg
cagctgggcccagatgtgtcccaagtctacccgccgcctgcacactctattccctaccaa
ggccttcccacagaggactcagtcggggtgttgtcagccttcccggagactcgcctgcag
atatcccctagcctgagccaaatgaacctgcccttcgtccagcctcacccctccctgctg
cagtgccagcctcaggagcatgccgtgtccagccccaagcctccgctgtgctcagatgtg
actatggcagaagacagctgcctgggccagcaggtggcagggttcccccagaacacctgg
cccagtgaagacatgttcccacccctgatgcctcccacggaacaggacctcaccaagctt
ctcctggaggggcaaggagaggcagggggagggtccctgggaccccagcccctcctccag
ccttcccactatgggcagactgggatctccatgtcccacctggacctaagagccaacccc
agctggtga

KEGG   Oryctolagus cuniculus (rabbit): 100344467
Entry
100344467         CDS       T03373                                 
Symbol
STAT2
Name
(RefSeq) signal transducer and activator of transcription 2
  KO
K11221  signal transducer and activator of transcription 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04062  Chemokine signaling pathway
ocu04217  Necroptosis
ocu04380  Osteoclast differentiation
ocu04621  NOD-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100344467 (STAT2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100344467 (STAT2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100344467 (STAT2)
   04625 C-type lectin receptor signaling pathway
    100344467 (STAT2)
   04062 Chemokine signaling pathway
    100344467 (STAT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100344467 (STAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100344467 (STAT2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100344467 (STAT2)
   05160 Hepatitis C
    100344467 (STAT2)
   05171 Coronavirus disease - COVID-19
    100344467 (STAT2)
   05164 Influenza A
    100344467 (STAT2)
   05162 Measles
    100344467 (STAT2)
   05168 Herpes simplex virus 1 infection
    100344467 (STAT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100344467 (STAT2)
   05169 Epstein-Barr virus infection
    100344467 (STAT2)
   05165 Human papillomavirus infection
    100344467 (STAT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100344467 (STAT2)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100344467 (STAT2)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 TPR_MLP1_2
Other DBs
NCBI-GeneID: 100344467
NCBI-ProteinID: XP_017197430
LinkDB
Position
4:complement(39918645..39937020)
AA seq 776 aa
MAQWEMLQDLDGPYQDLLHQLYSHSLLPVDIRQHLAAWIEDQNWREAVLGNDDSKATMLF
FHFLEQVNFECGRCSQDPECLLLQHNLRKFYRDLQAFPRGPTQLAEMMFNLLLEEEKILN
QAQRAQMEPGQPALGAPVESQQHDIESRLLDLKAMMEKLVKSISQLADLQDVFRFRYNTQ
AQGKAACSDPHWNRQQQLLQETLNELDKRRKEVLDDSKALLGRLTTLVDLLLPELDEWKA
QQQKACIGALQQPGLQQLEKWFTEGAKLLFHLWKLTKELQVTHLVTYENDPLIKGVDLQK
SQILELLKRLLYRAFVVETQPCMPQVLHRPLIIKTGSKFTARTRLLVRLQEGSESLTVEV
SIDRNPPQLQGFRKFNILTSNQKTLTPERGQSQGLVWDFGHLSLVEQRSGGSGKGSNKGT
LAVTEELHVISFTVKYTYQDLKLELRTDTLPVVVISNMNQLSIAXASILWFNLLSPNPQN
QQFFCSPPKAPWSLLGPALSWQFSSYVHRGLNPEQLAMLKDKLFGKSARNEDPLLSWADF
TKRESPPGKIPFWTWLDKILELVHDHLKELWKDGRIMGFVNRSQERRLLKKMVSGTFLLR
FSESSEGGITCSWVEHQEDDKVLICSVQPYTKEVLQSLPLTEIIRHYQLLTDENIPENPL
RFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQLDERQPPPLPLPLELEPKL
EPLELEPLELEPGLAPGPELALSLELGTLLETGLDLGLEPTLGLVPQSMPEPDMLP
NT seq 2331 nt   +upstreamnt  +downstreamnt
atggcacagtgggagatgctgcaggatctggacggcccatatcaggatctgctacaccag
ctgtactcacatagcctcctgccagtggacattcgacagcacttggctgcctggattgaa
gaccagaactggcgagaagctgtgctgggcaacgatgattctaaggctaccatgctgttc
ttccacttcttggagcaagtgaacttcgagtgtggccgctgcagtcaagaccctgagtgc
ttgttgctgcaacacaacttgagaaaattctaccgggaccttcaggccttccccagaggc
cctacccaattggctgaaatgatgtttaacctccttttggaagaagaaaaaattctgaat
caggctcagagggcccagatggagccaggccagccggctctgggagcacctgtggagagc
cagcagcatgatatcgagtcccggctcctggatttgaaggctatgatggagaagctggtg
aagtccatcagccagctggcagacctgcaggacgtcttccgcttccgctacaacacacag
gcccaagggaaggcagcctgttcggaccctcattggaacagacagcagcagctactgcaa
gaaaccctcaatgaactggacaaaaggagaaaggaggtgctggatgactccaaagcactg
ttaggccgactgactaccctcgtcgacctgctgctgccggagctggatgagtggaaagcc
cagcagcaaaaagcctgcattggagccctccagcagcctgggctgcaacagctggagaag
tggttcacagagggagccaagctgctgtttcacctgtggaagctaactaaggagctgcag
gtgacccacctggttacctacgagaatgaccctctgatcaaaggtgtagacctgcagaag
tcccagatcctagaactgctgaagcgtctgctctacagagcctttgtggtcgaaacccag
ccctgcatgccccaggttctccatcgacccctcatcatcaagacagggagcaagttcact
gcccgaacaaggctgctggtcagactccaggaaggcagtgagtccctgaccgtggaagtc
tccattgacaggaatcctcctcaattacaaggcttccggaagttcaacattctgacctca
aaccagaaaacgttgacacccgaaagggggcagagtcagggcttagtttgggactttggc
cacttgtccctggtggagcagcgttcaggcggctcagggaagggcagcaataaggggaca
ctggctgtcacagaggagctgcacgtcatcagcttcacggtcaaatacacctaccaggat
ctgaagctggagctgagaacagacaccctccctgtggtagtcatctccaacatgaaccag
ctctccattgcctgagcctccattctctggttcaatcttctcagccccaacccccagaac
cagcagttcttctgcagccccccgaaggccccctggagcttgctgggccccgctctcagt
tggcagttctcgtcctatgttcaccggggcctcaacccggagcagctcgccatgctcaag
gacaagctgtttgggaagagcgctaggaatgaggacccattgttgtcctgggccgacttc
accaagcgagaaagcccccctggcaagatccccttctggacgtggctggacaaaattcta
gagctggtgcatgaccacctcaaggagctctggaaagacgggcgcatcatgggctttgtg
aatcgcagccaagagcgccggctgctgaagaagatggtgtctggcactttccttctgcgc
ttcagtgaatcgtcagaagggggcattacctgctcctgggtggagcaccaggaggacgat
aaggtgctcatctgctcagtgcagccctacaccaaggaggtgctgcagtcgctcccgctg
actgaaatcatccgccactaccagctgctcaccgacgagaacatccccgagaacccactg
cgcttcctctacccccgaatcccccgcgatgaggcttttggatgctactaccaggaaaaa
gttaatctccaggaacggaggaaatacctgaaacataggctcattgtggtctccaacaga
cagttggatgagcggcagccaccgccactaccactgccactggagctggagccaaaattg
gagccgttagagctggagccgttagagctggagccggggctagcaccaggcccggagcta
gcgttaagcctggagttagggaccctgctggagacagggctggacctggggctggagccc
acgctgggcctggtgccacagagcatgccagagccagacatgcttccgtga

KEGG   Oryctolagus cuniculus (rabbit): 100348267
Entry
100348267         CDS       T03373                                 
Symbol
STAT5B
Name
(RefSeq) signal transducer and activator of transcription 5B
  KO
K11224  signal transducer and activator of transcription 5B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04012  ErbB signaling pathway
ocu04062  Chemokine signaling pathway
ocu04217  Necroptosis
ocu04630  JAK-STAT signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04917  Prolactin signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu05161  Hepatitis B
ocu05162  Measles
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05207  Chemical carcinogenesis - receptor activation
ocu05220  Chronic myeloid leukemia
ocu05221  Acute myeloid leukemia
ocu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100348267 (STAT5B)
   04630 JAK-STAT signaling pathway
    100348267 (STAT5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100348267 (STAT5B)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100348267 (STAT5B)
   04659 Th17 cell differentiation
    100348267 (STAT5B)
   04062 Chemokine signaling pathway
    100348267 (STAT5B)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100348267 (STAT5B)
   04935 Growth hormone synthesis, secretion and action
    100348267 (STAT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100348267 (STAT5B)
   05207 Chemical carcinogenesis - receptor activation
    100348267 (STAT5B)
   05203 Viral carcinogenesis
    100348267 (STAT5B)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100348267 (STAT5B)
   05220 Chronic myeloid leukemia
    100348267 (STAT5B)
   05223 Non-small cell lung cancer
    100348267 (STAT5B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100348267 (STAT5B)
   05161 Hepatitis B
    100348267 (STAT5B)
   05162 Measles
    100348267 (STAT5B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100348267 (STAT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100348267 (STAT5B)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100348267 (STAT5B)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 100348267
NCBI-ProteinID: XP_017204828
Ensembl: ENSOCUG00000005078
LinkDB
Position
19:complement(43015853..43041902)
AA seq 786 aa
MAVWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETTLQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSGHLEDYSSMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCEPATAKAVDGYVKPQIKQVVPEFANASGEGGA
SATYMDQAPSPAVCPQTHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQW
IPHAQS
NT seq 2361 nt   +upstreamnt  +downstreamnt
atggctgtgtggatacaagcccagcagctgcaaggagatgcccttcaccagatgcaagcg
ctgtacggccagcacttccccatcgaggtgcgccactacctgtcccagtggatcgaaagc
caagcctgggactcaatagatcttgataatccacaggagaatattaaggccacccagctc
ctggagggcctggtgcaagagctgcagaagaaggcggagcatcaggtgggggaagatggg
tttttactgaagatcaagctgggccactacgccacccagctccagaacacgtacgaccgc
tgccccatggagctggtccgctgcatccggcacattctgtacaacgaacagaggctggtc
cgggaagccaacaatggtagttctcccgctgggagcctggccgacgccatgtcccagaag
caccttcagatcaaccagacgttcgaggagctgcggctggtcacgcaggacacggagaac
gagctgaagaagctgcagcagactcaggagtacttcatcatccagtaccaggagagcctg
aggatccaagcccagtttgcgcaactggcccagctgaacccccaggagcggctgagcagg
gagacgaccctgcagcagaagcaggtgtccctggaggcctggctgcagcgtgaggcccag
acactgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagacgatcatcctggacgacgagctgatccagtggaagcggcggcagcag
ctggccggcaacggagggccccctgagggcagcctggacgtgctgcagtcctggtgtgag
aagttggctgagatcatctggcagaaccggcagcaaatccgcagagccgagcacctctgc
cagcagctgcccatccccggccccgtggaggagatgctggccgaggtcaacgccaccatc
acggacatcatctccgccctggtgaccagcacattcatcatcgagaagcagcccccgcag
gtcctgaagacccagaccaagttcgcggccaccgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgaaggccaccatcatcagtgagcagcaggccaag
tccctgctcaagaacgagaacacccgcaacgagtgcagcggcgagatcctgaacaactgc
tgtgtcatggaatatcaccaagccactggcaccctcagcgcccacttcaggaacatgtcc
ctgaaacgaatcaagaggtccgaccgccgtggagcggagtcggtgacagaagaaaaattt
accatcctgtttgaatcacagttcagcgttggggggaatgagctggtatttcaggtcaag
accctgtcactccccgtggtggtgatcgttcatggcagccaggacaacaacgcgacagcc
accgttctctgggacaatgcttttgccgagcctggcagagtgccattcgccgtgcctgac
aaagtgctgtggccgcagctgtgcgaggcgctcaacatgaaattcaaggccgaggtgcag
agcaaccggggcctgaccaaggagaacctggtgttcctggcgcagaagctgttcaacagc
agcagcggccacctggaggactacagcagcatgtccgtgtcctggtcccagttcaacagg
gagaacttgccaggacgaaattacaccttctggcagtggtttgacggggtgatggaagtg
ttgaaaaagcatctcaagcctcattggaacgatggggcgattctgggttttgtgaacaag
caacaggcccatgacttactcatcaacaagccagatgggaccttcctcctgagattcagc
gactcggaaatcggtggcatcaccattgcttggaagtttgattctcaggaaagaatgttt
tggaatctgatgccatttactaccagagacttctccatccggtccctggctgaccgcttg
ggggacttgaattaccttatatatgtgtttcctgatcggccaaaagacgaagtgtactcc
aagtattacacgcccgttccctgtgagcctgccaccgctaaggcggtggacgggtacgtg
aagccgcagatcaagcaagtggtccctgagtttgccaacgcgtctggagaggggggggcc
agcgccacctacatggaccaggccccgtccccggctgtgtgtccccagacgcactacaac
atgtacccacagaaccctgactccgtccttgacaccgatggggacttcgacctggaagac
acgatggacgtggcgcgccgcgtggaggagctcctgggccgccccatggacagtcagtgg
atcccccacgcccagtcgtga

KEGG   Oryctolagus cuniculus (rabbit): 100348518
Entry
100348518         CDS       T03373                                 
Name
(RefSeq) signal transducer and activator of transcription 5A
  KO
K11223  signal transducer and activator of transcription 5A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04012  ErbB signaling pathway
ocu04217  Necroptosis
ocu04630  JAK-STAT signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04917  Prolactin signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu05161  Hepatitis B
ocu05162  Measles
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05207  Chemical carcinogenesis - receptor activation
ocu05220  Chronic myeloid leukemia
ocu05221  Acute myeloid leukemia
ocu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100348518
   04630 JAK-STAT signaling pathway
    100348518
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100348518
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100348518
   04659 Th17 cell differentiation
    100348518
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100348518
   04935 Growth hormone synthesis, secretion and action
    100348518
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100348518
   05207 Chemical carcinogenesis - receptor activation
    100348518
   05203 Viral carcinogenesis
    100348518
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100348518
   05220 Chronic myeloid leukemia
    100348518
   05223 Non-small cell lung cancer
    100348518
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100348518
   05161 Hepatitis B
    100348518
   05162 Measles
    100348518
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100348518
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100348518
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100348518
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 100348518
NCBI-ProteinID: XP_002719440
Ensembl: ENSOCUG00000023066
UniProt: G1U4K1
LinkDB
Position
19:43101112..43121266
AA seq 793 aa
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDSPQDRAQAAQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGASPAGTLADALSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETTLQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSGHLEDYSSMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFANASGEGGASATYV
DQAPSPAVCPQTHYNMYPQNPDPVLDQEGEFDLDETMDVARHVEELLRRPMDGLNPRLSP
PAALFTAARSSLS
NT seq 2382 nt   +upstreamnt  +downstreamnt
atggcgggctggattcaggcccagcagctgcagggagacgcgctgcgccagatgcaggtg
ctctatggccagcacttccccatcgaggtccggcactacctggcacagtggatcgagagc
cagccatgggatgccatcgacctggacagcccccaggaccgagcccaggctgcccagctc
ctggagggcctggtgcaagagctgcagaagaaggcggagcatcaggtgggggaagatggg
tttttactgaagatcaagctgggccactacgccacccagctccagaacacgtacgaccgc
tgccccatggagctggtccgctgcatccggcacattctgtacaacgaacagaggctggtc
cgggaagccaacaatggcgcctctcccgctgggaccctggccgatgccttgtcccagaag
caccttcagatcaaccagacgttcgaggagctgcggctggtcacgcaggacacggagaat
gagctgaagaagctgcagcagactcaggagtacttcatcatccagtaccaggagagcctg
aggatccaagcccagtttgcgcagctggcccagctgaacccccaggagcggctgagcagg
gagacgaccctgcagcagaagcaggtgtccctggaggcctggctgcagcgtgaggcccag
acactgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagacgatcatcctggacgacgagctgatccagtggaagcggcggcagcag
ctggcgggcaacggagggccccccgagggcagcctggacgtgctgcagtcctggtgtgag
aagttggctgagatcatctggcagaaccggcagcaaatccgcagagccgagcacctctgc
cagcagctgcccatccccggccccgtggaggagatgctggccgaggtcaacgccaccatc
acggacatcatctccgccctggtgaccagcacattcatcatcgagaagcagcccccgcag
gtcctgaagacccagaccaagttcgcggccaccgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgaaggccaccatcatcagtgagcagcaggccaag
tccctgctcaagaacgagaacacccgcaacgagtgcagtggcgagatcctgaacaattgt
tgcgtcatggaatatcaccaagccaccggcaccctcagcgcccacttcaggaacatgtca
ctgaagaggatcaagcgtgcggaccgccggggtgcggagtcggtgacggaggagaagttc
acggtcctcttcgagtcgcagttcagcgttggcagcaatgagcttgtgttccaggtgaag
acgctgtccctccccgtggttgtcattgtccacggcagccaggaccacaacgccacggcc
actgtgctgtgggacaacgcctttgctgagccgggcagagtgccattcgccgtgcctgac
aaagtgctgtggccgcagctgtgcgaggcgctcaacatgaaattcaaggccgaggtgcag
agcaaccggggcctgaccaaggagaacctggtgttcctggcgcagaagctgttcaacagc
agcagcggccacctggaggactacagcagcatgtccgtgtcctggtcccagttcaacagg
gagaacctgcccggctggaactacaccttctggcagtggttcgatggggtgatggaggtg
ctgaagaagcatcacaagccgcactggaacgacggggccatcctcggttttgtgaataag
cagcaggcccacgacctgctcatcaacaagcccgatggcaccttcctgctgcgctttagc
gactcagaaatcgggggcatcaccatcgcctggaagtttgactcccctgaccgcaacctg
tggaacctgaagccgttcaccacgcgggatttctccattcggtccctggccgaccgcctg
ggagacctgaactatctcatctatgtctttccggaccgccccaaggacgaggtcttctcc
aagtactacacgcctgtgctcgctaaggcggtggacgggtatgtgaagccacagatcaag
caagtggtccctgagtttgccaacgcgtctggagaggggggggccagcgccacctacgtg
gaccaggccccgtccccggctgtgtgtccccagacgcactacaacatgtacccacagaac
ccggaccccgtcctggaccaggaaggagagttcgacttggacgagaccatggatgtggcc
cggcatgtggaggagctcctgcgccgccccatggacggtctcaacccgcgcctgtccccg
cccgccgcgctcttcacggctgccaggagctccctctcctga

DBGET integrated database retrieval system