KEGG   Oryctolagus cuniculus (rabbit): 100345409
Entry
100345409         CDS       T03373                                 
Symbol
IL7
Name
(RefSeq) interleukin 7
  KO
K05431  interleukin 7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04640  Hematopoietic cell lineage
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100345409 (IL7)
   04151 PI3K-Akt signaling pathway
    100345409 (IL7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100345409 (IL7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100345409 (IL7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100345409 (IL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100345409 (IL7)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100345409 (IL7)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100345409 (IL7)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Cytokines
   100345409 (IL7)
SSDB
Motif
Pfam: IL7
Other DBs
NCBI-GeneID: 100345409
NCBI-ProteinID: XP_008253909
Ensembl: ENSOCUG00000029611
LinkDB
Position
3:complement(94497308..94538927)
AA seq 169 aa
MFHVSFRYIFGIPPLILVLLPVTSSNCDIEKIKHGKEYENVLMISINELGLAEDVAHWPL
DKMIEIGSNCLNNESNFFKKHSCDDNKEADFLERAARKLDQFHDMSINEDFQNHLERVSK
GTLTLVNCTGKEEKKPLKDQKKNGRCFLKKLLQKIKTCWNKILRGIKEN
NT seq 510 nt   +upstreamnt  +downstreamnt
atgttccatgtttcttttaggtatatctttggaattcctcctttgatccttgttctgttg
ccagtgacatcatctaattgtgatattgagaaaattaaacatggcaaagaatatgagaat
gttctaatgatcagcatcaatgaattgggtttggcagaggacgttgcacattggccctta
gacaaaatgatagaaattggtagcaattgcctgaataatgaatctaacttttttaaaaaa
cattcatgtgatgataataaggaagctgattttctagaacgtgctgctcgcaagttggat
cagtttcatgatatgagtatcaatgaggatttccaaaaccacttagaaagagtatcgaag
ggcacattaacactggtgaactgcactggtaaggaagaaaagaaacctttaaaggatcag
aaaaagaatggccggtgtttcctaaagaaactactacaaaagataaaaacttgttggaat
aaaattttgaggggcattaaagaaaactga

DBGET integrated database retrieval system