KEGG   Oryctolagus cuniculus (rabbit): 100346189
Entry
100346189         CDS       T03373                                 

Symbol
CXCR4
Name
(RefSeq) C-X-C motif chemokine receptor 4
  KO
K04189  C-X-C chemokine receptor type 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04020  Calcium signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04144  Endocytosis
ocu04360  Axon guidance
ocu04670  Leukocyte transendothelial migration
ocu04672  Intestinal immune network for IgA production
ocu04810  Regulation of actin cytoskeleton
ocu05163  Human cytomegalovirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100346189 (CXCR4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100346189 (CXCR4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100346189 (CXCR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100346189 (CXCR4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100346189 (CXCR4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100346189 (CXCR4)
   04672 Intestinal immune network for IgA production
    100346189 (CXCR4)
   04062 Chemokine signaling pathway
    100346189 (CXCR4)
  09158 Development and regeneration
   04360 Axon guidance
    100346189 (CXCR4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100346189 (CXCR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100346189 (CXCR4)
   05163 Human cytomegalovirus infection
    100346189 (CXCR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100346189 (CXCR4)
   04050 Cytokine receptors [BR:ocu04050]
    100346189 (CXCR4)
   04090 CD molecules [BR:ocu04090]
    100346189 (CXCR4)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    100346189 (CXCR4)
Cytokine receptors [BR:ocu04050]
 Chemokine receptors
  CXC Chemokine
   100346189 (CXCR4)
CD molecules [BR:ocu04090]
 Proteins
  100346189 (CXCR4)
SSDB
Motif
Pfam: 7tm_1 CXCR4_N 7TM_GPCR_Srsx COX2_TM Cybc1_Eros
Other DBs
NCBI-GeneID: 100346189
NCBI-ProteinID: XP_002712170
Ensembl: ENSOCUG00000001923
LinkDB
Position
7
AA seq 352 aa
MEGISIYTSDNYTEELGSGDYDSIKEPCFREENAHFNRIFLPTIYSIIFLTGIVGNGLVI
LVMGYQKKQRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGKFLCKAVHVIYTVNL
YSSVLILAFISLDRYLAIVHATNSQKPRKLLAEKVVYVGVWIPALLLTIPDFIFANVREA
EGRYICDRFYPSDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT
TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggaagggatcagtatttacacttcagacaactacacggaggaattgggctcaggggac
tatgactccataaaggagccctgcttccgggaggaaaacgcccatttcaaccgcatcttc
ctgcccaccatctactccatcatcttcttgactggcatagtgggcaatgggctggtcatc
ttggtcatgggttaccagaagaagcagagaagcatgacagacaagtacaggctgcacctg
tcggtggccgatctcctgtttgtcatcacgcttcccttctgggcagtggatgctgtggcg
aattggtacttcgggaagttcctgtgcaaagctgtccatgtcatctacacagtcaacctc
tatagcagtgtcctcatcctggccttcatcagtctggatcggtacctggccatcgtccat
gccactaacagtcagaagccaaggaagctattggctgagaaggtggtctacgtcggtgtc
tggattcctgctctcctgctgactattcccgatttcatctttgccaatgtcagagaggca
gaggggaggtacatctgtgaccgcttctaccccagtgacctgtgggtggttgtgttccag
tttcagcacatcatggttggccttatcctgccgggtatcgtcatcctgtcctgctattgc
ataatcatctccaagctgtcacactccaagggccaccagaagcgcaaggccctcaagacc
actgtcatcctcatcctggccttcttcgcctgctggctgccctactacattgggatcagc
atcgactcattcatcctcctggaaatcatcaagcaaggatgtgagtttgagaacactgtg
cacaaatggatttctatcaccgaggccctagcctttttccactgttgtctcaatcccatc
ttgtatgccttcctcggggccaaatttaaaacctctgctcagcacgcactcacctctgtg
agcagagggtccagcctcaagattctctccaaaggaaagcggggtggacattcttctgtt
tcaaccgagtctgaatcttcaagttttcactccagctaa

DBGET integrated database retrieval system