KEGG   Oryctolagus cuniculus (rabbit): 100348133
Entry
100348133         CDS       T03373                                 
Symbol
TNFRSF11B
Name
(RefSeq) TNF receptor superfamily member 11b
  KO
K05148  tumor necrosis factor receptor superfamily member 11B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100348133 (TNFRSF11B)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100348133 (TNFRSF11B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100348133 (TNFRSF11B)
Cytokine receptors [BR:ocu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100348133 (TNFRSF11B)
SSDB
Motif
Pfam: TNFR_c6 Death Ephrin_rec_like
Other DBs
NCBI-GeneID: 100348133
NCBI-ProteinID: XP_002710649
Ensembl: ENSOCUG00000011150
UniProt: G1T0Q8
LinkDB
Position
3:complement(134828524..134858054)
AA seq 401 aa
MNKLLCCALVFLDISIKWTMQETLPPKYLHYDPETSRQLMCDKCPPGTYLKQHCTARRET
LCTPCPDHYYTDTWHTSEECLYCSSVCKELQHVKQECNRTHNRVCECEEGRYLDLEFCVK
HRSCPPGFGVAQAGTPERNTVCKRCPDGFFSDEMSSKAPCRKHTNCSALGLLLTQKGNAT
HDNVCSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGSKVNAESVERI
KRRHSSQEQTFQLLKLWKHQNKDQDMVKKIIQDIDLCENSVQRHIGHANLTLDQLRSLME
SLPGKKVGAEAIEKARRACKSSEQLPKLLSLWRTKNGDQDSLKGLMHALKHLKTYHFPKS
VTQSLRKTIRFLHSFTMYRLYQKLFLEMIGNQVQSVKISCL
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgaacaagttgctgtgctgcgcgctcgtgttcctggacatctccattaaatggaccatg
caggaaacccttcctccaaagtatctccattatgatccagaaacctctcgtcagctgatg
tgtgacaaatgtcctcctggcacctacctgaagcagcactgtacagcaaggcgggagacc
ctgtgcaccccttgcccggaccactactacacagacacttggcacaccagtgaagagtgt
ctgtattgcagctccgtgtgcaaggagttgcagcacgtcaagcaggagtgcaatcgcacc
cacaaccgtgtgtgtgaatgcgaggaagggcgctacctcgatctagagttctgtgtgaag
cacaggagctgcccccctgggtttggagtggcacaagctggaaccccagagcggaataca
gtttgcaaaagatgtccagatggattcttttcggatgagatgtcttctaaagccccctgt
cgaaaacacacaaattgcagtgcacttggtttgctgctaactcagaaaggaaatgcaaca
catgacaatgtatgttctggaaacagtgaatcaactcaaaaatgtggaatagatgtcacc
ttatgtgaggaggcattcttcaggtttgctgttcctacaaagtttacacccaactggctc
agtgtcctggtagacaatttgcctggaagcaaagtaaatgctgagagtgtagagaggata
aaacggcggcatagttcacaagaacaaacattccagctgctgaagttatggaaacatcaa
aataaagaccaagacatggtcaagaagatcatccaagatattgacctctgtgaaaacagt
gtgcagcggcacattgggcacgcaaacctcaccttggatcagcttcgcagcttgatggag
agtttacccgggaagaaagtaggagcagaagccattgaaaaagcaagaagggcttgcaaa
tcaagtgagcagctccccaagctgctcagtctgtggagaacaaagaatggagaccaagac
tctttgaagggcctcatgcatgccctgaagcacttgaaaacctaccactttcccaagagc
gtcactcagagtctgaggaagaccatcaggttccttcacagcttcacaatgtacagactg
taccagaagctatttttagagatgatagggaaccaggtccaatcagtaaaaataagctgc
ttataa

DBGET integrated database retrieval system