KEGG   Oryctolagus cuniculus (rabbit): 100348477
Entry
100348477         CDS       T03373                                 

Symbol
CASP8
Name
(RefSeq) caspase 8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04668  TNF signaling pathway
ocu04932  Non-alcoholic fatty liver disease
ocu04936  Alcoholic liver disease
ocu05010  Alzheimer disease
ocu05016  Huntington disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05134  Legionellosis
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05416  Viral myocarditis
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100348477 (CASP8)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100348477 (CASP8)
   04215 Apoptosis - multiple species
    100348477 (CASP8)
   04217 Necroptosis
    100348477 (CASP8)
   04115 p53 signaling pathway
    100348477 (CASP8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100348477 (CASP8)
   04621 NOD-like receptor signaling pathway
    100348477 (CASP8)
   04622 RIG-I-like receptor signaling pathway
    100348477 (CASP8)
   04625 C-type lectin receptor signaling pathway
    100348477 (CASP8)
   04657 IL-17 signaling pathway
    100348477 (CASP8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100348477 (CASP8)
   05203 Viral carcinogenesis
    100348477 (CASP8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100348477 (CASP8)
   05161 Hepatitis B
    100348477 (CASP8)
   05160 Hepatitis C
    100348477 (CASP8)
   05164 Influenza A
    100348477 (CASP8)
   05162 Measles
    100348477 (CASP8)
   05168 Herpes simplex virus 1 infection
    100348477 (CASP8)
   05163 Human cytomegalovirus infection
    100348477 (CASP8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100348477 (CASP8)
   05169 Epstein-Barr virus infection
    100348477 (CASP8)
   05165 Human papillomavirus infection
    100348477 (CASP8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100348477 (CASP8)
   05134 Legionellosis
    100348477 (CASP8)
   05152 Tuberculosis
    100348477 (CASP8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100348477 (CASP8)
   05142 Chagas disease
    100348477 (CASP8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100348477 (CASP8)
   05016 Huntington disease
    100348477 (CASP8)
   05022 Pathways of neurodegeneration - multiple diseases
    100348477 (CASP8)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100348477 (CASP8)
   05416 Viral myocarditis
    100348477 (CASP8)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100348477 (CASP8)
   04932 Non-alcoholic fatty liver disease
    100348477 (CASP8)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100348477 (CASP8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100348477 (CASP8)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     100348477 (CASP8)
Peptidases and inhibitors [BR:ocu01002]
 Cysteine peptidases
  Family C14: caspase family
   100348477 (CASP8)
SSDB
Motif
Pfam: DED Peptidase_C14 PYRIN
Other DBs
NCBI-GeneID: 100348477
NCBI-ProteinID: XP_017198518
LinkDB
Position
7
AA seq 478 aa
MDLSSCLYKIGEQLDSEELASLKFLSLDYIPQRKQEPIQDALMLFQRLQEKRMLEENNLA
FLKELLFRIHRLDLLSTLLGTSKEEMVTELQIPGRAHISAYRVMLFQISEDVSQLELKAF
KFFLSREISKCKLEDNMSLLDIFIEMEKRALLGDRNLDTLKKICEQINKSLLVKIHDYED
CSQGRRMSLGRTPGACSNGEEPYGVLALSDCPGEPASKAQTSEEVYQMKSKPRGYCLIVN
NYDFSIARREMPRHRNMKDRKGTEVDAEALSNTFTDLHFEVVHYNDCTAKQICDILQSYQ
SMDHKDRDCFVCCILSHGDKGIIYGTDGQEACIYDLTSYFTGSKCPSLAGKPKVFFIQAC
QGDKYQQAVPVAIDSEQQETYLEMDSSFPKRYVPDEADFLLGMATVNNCVSYRNLFEGTW
YIQSLCQSLRERCPQGEDILSILTKVNYKVSIKEAGEKKKQMPQPTFTLTKRLLFPLD
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggatttatccagttgtctttacaaaattggggagcagctggacagcgaggagctggcc
tccctgaagttcctgagcctggattacatcccacaaaggaagcaggagcccatccaggat
gccttgatgctattccagagactccaggagaagcgcatgctggaggagaacaacctggcc
ttcctgaaggagctgctcttccgaatccacagactggatctgctgagcactctgctgggc
actagcaaggaggagatggtgacggagctgcagatcccaggcagggcccatatttctgcc
tacagggtcatgctcttccagatttcagaagacgtaagccaactggaattgaaggctttt
aaattttttttgagcagggagatctccaaatgtaaactggaagataacatgagcttgctg
gacatcttcatcgagatggagaagagggccctccttggggatagaaacttggacaccctg
aaaaagatctgtgagcaaatcaacaagagcctgctggtgaaaatccacgattatgaagac
tgcagccaagggagaagaatgagcctgggaagaactcccggcgcatgttcaaacggggag
gagccatatggagtgctggcactgtcagactgtccaggggagccagcgagcaaggcacag
acatcagaagaagtttaccaaatgaaaagcaaacctcggggatactgtttgatcgtcaac
aactacgattttagcatagcacggagagaaatgcccagacaccgcaacatgaaagacagg
aaaggaacagaagttgatgcagaggctttgagcaataccttcactgaccttcactttgaa
gtagtccattacaatgactgcacggcaaagcagatctgtgacattctgcaaagctaccaa
agcatggaccacaaagacagagactgcttcgtctgctgcatcctgtcccatggagacaag
ggcatcatctatggcactgatgggcaggaggcctgcatctatgatctgacctcttatttc
actggttcgaagtgcccctctcttgctggaaaacccaaagtctttttcattcaagcttgt
caaggggataagtaccagcaagccgttcctgttgcgatagactcagagcagcaagaaacc
tatttagaaatggactcatcgtttccaaagagatacgtccccgatgaggctgacttcctg
ctggggatggccactgtgaacaactgtgtctcctatcgaaacctctttgaggggacctgg
tacatccagtcactttgccagagcctaagagaaagatgtcctcaaggcgaagatatcctc
tccatcctgaccaaagtgaactataaagtgagcattaaggaagctggggaaaaaaagaag
cagatgccacagcctactttcacactaacaaagagactcctcttccctctggattga

DBGET integrated database retrieval system