KEGG   Oryctolagus cuniculus (rabbit): 100349102
Entry
100349102         CDS       T03373                                 

Symbol
LCK
Name
(RefSeq) LCK proto-oncogene, Src family tyrosine kinase
  KO
K05856  lymphocyte cell-specific protein tyrosine kinase [EC:2.7.10.2]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04064  NF-kappa B signaling pathway
ocu04380  Osteoclast differentiation
ocu04650  Natural killer cell mediated cytotoxicity
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu05135  Yersinia infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100349102 (LCK)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100349102 (LCK)
   04660 T cell receptor signaling pathway
    100349102 (LCK)
   04658 Th1 and Th2 cell differentiation
    100349102 (LCK)
   04659 Th17 cell differentiation
    100349102 (LCK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100349102 (LCK)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100349102 (LCK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100349102 (LCK)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100349102 (LCK)
  09163 Immune disease
   05340 Primary immunodeficiency
    100349102 (LCK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100349102 (LCK)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100349102 (LCK)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100349102 (LCK)
Protein kinases [BR:ocu01001]
 Non-receptor tyrosine kinases
  SRC family
   100349102 (LCK)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100349102 (LCK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_2 SH3_9 ABC1 Haspin_kinase Kdo SH3_16
Other DBs
NCBI-GeneID: 100349102
NCBI-ProteinID: XP_002720675
Ensembl: ENSOCUG00000003668
LinkDB
Position
Un
AA seq 510 aa
MGCSCSSNPEDDWMENIDVCENCHYPIVPLEGKATLPIRNGSEVRDPLVTYEGSNPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQNGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLDSGKSESTAGSFSLSVRDFDQNQGEVVK
HYKIRNLDNGGFYISPRITFPGLHELVRHYTSAPDGLCTRLSRPCQTQKPQKPWWEDEWE
VPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQR
LVRLYAVVTQEPIYIITEYMENGSLVDFLKTPTGIKLTINKLLDMAAQIAEGMAFIEERN
YIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTI
KSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPENCPEELYHLMKLCWKE
RPEDRPTFDYLRSVLEDFFTATEGQYQPQP
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgggctgtagctgcagctcaaaccctgaagatgactggatggaaaacatcgacgtgtgt
gagaactgccactaccccatagtcccactggaaggcaaggccacgctgcccatccggaac
ggctctgaggttcgggacccactggtcacctatgaaggctcaaaccctccggcatcccca
ctgcaagacaacctggttatcgccctgcacagctatgagccctctcacgacggagacctg
ggcttcgagaagggagaacagctccgtatcctggagcagaacggggagtggtggaaggcg
cagtccctgaccacaggccaggaaggcttcatccccttcaacttcgtggccaaagcgaac
agcctggagcccgaaccctggttcttcaagaacctaagccgcaaggacgcagagcggcag
ctcctggcgcccgggaacacgcacggctcctttcttgattccgggaagagcgagagcacc
gcgggatcattttcactgtcggtgcgggatttcgaccagaaccagggagaggtggtgaaa
cattacaagatccgtaacctggacaacggcggcttctacatctcccctcgcatcactttt
ccaggcctgcacgagctggtccgccattacaccagtgctccggacgggctgtgcacgcgg
ctgagccgcccctgccagacccagaagccccagaagccttggtgggaggacgaatgggag
gttcccagggagacgctgaagctggtggagcggctcggggccggacagttcggggaggtg
tggatgggctattacaacgggcacacaaaggtggcggtgaagagcctgaagcagggcagc
atgtcccccgacgccttcctggccgaggccaacctcatgaagcagctgcagcaccagcgg
ctggtccggctctacgcggtggtcacccaggagcccatctacatcatcacggaatacatg
gaaaacgggagcttagtggattttctcaagacccctacaggcatcaaattgaccatcaac
aaactcttggacatggcagcccaaattgcagagggcatggcattcattgaagagcggaat
tatatccaccgggacctgcgggctgccaacatcctggtttctgacaccctgagctgcaag
attgcagactttggcctagcgcgcctcattgaggacaatgaatacacagccagggaagga
gccaagtttcctattaagtggacagcaccagaagccattaactatgggacattcaccatc
aagtcagatgtgtggtcctttgggatcctgctgacggagatcgtcactcatggccgcatc
ccttacccagggatgactaatcctgaagtgatccagaacctggagcggggctaccgcatg
gtgcgccctgagaactgcccagaggagctgtaccacctcatgaagctgtgctggaaagag
cgcccagaggaccggcccacctttgactacctgcgcagcgtgctggaggacttcttcacg
gccacagagggccagtaccagccccagccttga

DBGET integrated database retrieval system