KEGG   Oryctolagus cuniculus (rabbit): 100349106
Entry
100349106         CDS       T03373                                 

Symbol
CD40
Name
(RefSeq) CD40 molecule
  KO
K03160  tumor necrosis factor receptor superfamily member 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04064  NF-kappa B signaling pathway
ocu04514  Cell adhesion molecules
ocu04620  Toll-like receptor signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05166  Human T-cell leukemia virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05202  Transcriptional misregulation in cancer
ocu05310  Asthma
ocu05320  Autoimmune thyroid disease
ocu05322  Systemic lupus erythematosus
ocu05330  Allograft rejection
ocu05340  Primary immunodeficiency
ocu05416  Viral myocarditis
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100349106 (CD40)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100349106 (CD40)
   04514 Cell adhesion molecules
    100349106 (CD40)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100349106 (CD40)
   04672 Intestinal immune network for IgA production
    100349106 (CD40)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100349106 (CD40)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100349106 (CD40)
   05169 Epstein-Barr virus infection
    100349106 (CD40)
  09174 Infectious disease: parasitic
   05144 Malaria
    100349106 (CD40)
   05145 Toxoplasmosis
    100349106 (CD40)
  09163 Immune disease
   05310 Asthma
    100349106 (CD40)
   05322 Systemic lupus erythematosus
    100349106 (CD40)
   05320 Autoimmune thyroid disease
    100349106 (CD40)
   05330 Allograft rejection
    100349106 (CD40)
   05340 Primary immunodeficiency
    100349106 (CD40)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100349106 (CD40)
   05416 Viral myocarditis
    100349106 (CD40)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100349106 (CD40)
   04090 CD molecules [BR:ocu04090]
    100349106 (CD40)
Cytokine receptors [BR:ocu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100349106 (CD40)
CD molecules [BR:ocu04090]
 Proteins
  100349106 (CD40)
SSDB
Motif
Pfam: TNFR_c6 RANK_CRD_2
Other DBs
NCBI-GeneID: 100349106
NCBI-ProteinID: XP_002721245
Ensembl: ENSOCUG00000005631
LinkDB
Position
Un
AA seq 277 aa
MLRLPVRCVLWGCLLTAVLPEPPTACRENQYQVNNQCCNLCPPGERLENECVDGTNTKCL
PCSNGEFLDTWNRETRCHQHKYCDPNLGLQVQREGTSETDTTCTCQEGQHCISDACDSCA
PHSSCPVGFGVRQKATEVSDTICEPCPDGFFSNVSSAVESCHPWTSCATHNLVELQAGTN
KTDVRCGAQDRKRALVLIPMVLGGVSAALLVSVYIRKAIKKPIDKGYRVRTVGQDPVEME
DFPGHNTGAPVQETLHGCQPVTQEDGKESRIAVQERQ
NT seq 834 nt   +upstreamnt  +downstreamnt
atgcttcggctgcctgtgcggtgtgtcctctggggctgcttgctgaccgccgtcctccca
gaaccgcccactgcctgcagggaaaatcagtaccaagtgaacaatcagtgctgcaatttg
tgcccgccaggagagagactggagaatgaatgcgtagacggcaccaacacaaaatgcctt
ccttgctctaatggcgaattcttagacacctggaacagggagacgcgctgccaccagcac
aagtactgcgaccccaacctagggctccaggtccagagggagggcacctcggagacagat
accacctgcacctgtcaagaaggtcaacattgcatcagcgatgcctgcgacagctgtgcc
ccacacagctcctgccccgtgggctttggggtcaggcagaaggccaccgaggtttctgat
accatctgtgaaccctgcccggacggcttcttctccaatgtgtcgtctgctgttgaaagc
tgtcacccatggacaagctgtgcgacccacaacctcgtggagctacaggcgggaactaac
aagacagacgtgcgctgtggtgcccaggaccggaagagagccctggtgttgattcccatg
gtgctggggggcgtgtccgctgccctcttggtgtccgtttatatccgcaaggcgatcaag
aagccaatagataagggctaccgcgtccggacggtggggcaggaccccgtggagatggag
gacttccccggccataacacgggtgcgccggtccaggagaccttgcacgggtgccagccg
gtcacccaggaggacggcaaggagagccgcatcgccgtgcaggagcggcagtga

DBGET integrated database retrieval system