KEGG   Oryctolagus cuniculus (rabbit): 100349321
Entry
100349321         CDS       T03373                                 
Symbol
IL27
Name
(RefSeq) interleukin 27
  KO
K22629  interleukin 27 subunit alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100349321 (IL27)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100349321 (IL27)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100349321 (IL27)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100349321 (IL27)
SSDB
Motif
Pfam: CNTF
Other DBs
NCBI-GeneID: 100349321
NCBI-ProteinID: XP_017198096
LinkDB
Position
6:18599443..18605096
AA seq 218 aa
MGQTAGNLGWRLSLLLLSLLLVRAGVWGFPRPPQSPQELRREFTVSLHLARKLLSEVRGQ
AHRFAEAHLPGVNLDLLPLGEQFPNVSLTFQVWRQLSDSERLCFLSAALRPFRGLLGELG
TSQPGHCLTPGLLLQVLAAGCDLPEQEEREEGKGLLPGAPGGPSPAWAQLSWPQLLYNYQ
LLHSLELVLSRAVRDLLLLSKAGHPVQALGLPTTQPQP
NT seq 657 nt   +upstreamnt  +downstreamnt
atgggccagacagcgggcaacctcggctggcggctcagcctgctgctgctgtccttgctc
ctggtgcgagccggcgtctggggattcccaaggcccccgcagagcccgcaggagctgcgc
agggagttcacggtcagcttgcacctcgccaggaagctgctgtctgaggttcgaggccaa
gcgcaccgctttgctgaagctcacctgccgggggtgaacttggacctcctgcccttgggg
gagcagttccccaacgtgtccttgaccttccaggtctggcgccagctctctgactcagaa
cgactctgcttcctctccgcggcgctccggcccttccgcggcctgctgggggagctgggg
acttctcagcctggccactgtctgacccctgggcttctcctacaggtgctggccgcagga
tgcgacctccccgagcaagaggaaagggaagaggggaaggggctgctcccaggggctcca
ggcggcccctccccagcgtgggcccagctgtcctggccccagctcctctacaactaccag
ctgctgcactccctggagctcgtgctgtcgcgggctgtgcgggatttgctgctgctatcc
aaagccgggcaccctgtccaggccttggggctccccaccacccagccccagccctga

DBGET integrated database retrieval system