KEGG   Oryctolagus cuniculus (rabbit): 100349330
Entry
100349330         CDS       T03373                                 
Symbol
IL6ST
Name
(RefSeq) interleukin 6 signal transducer
  KO
K05060  interleukin 6 signal transducer
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04630  JAK-STAT signaling pathway
ocu04659  Th17 cell differentiation
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100349330 (IL6ST)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100349330 (IL6ST)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100349330 (IL6ST)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100349330 (IL6ST)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100349330 (IL6ST)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100349330 (IL6ST)
   05203 Viral carcinogenesis
    100349330 (IL6ST)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100349330 (IL6ST)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100349330 (IL6ST)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100349330 (IL6ST)
   04090 CD molecules [BR:ocu04090]
    100349330 (IL6ST)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL6/12 receptor family
   100349330 (IL6ST)
CD molecules [BR:ocu04090]
 Proteins
  100349330 (IL6ST)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 IL6Ra-bind EpoR_lig-bind Pur_ac_phosph_N fn3_2 ObR_Ig
Other DBs
NCBI-GeneID: 100349330
NCBI-ProteinID: XP_008260448
Ensembl: ENSOCUG00000007839
UniProt: G1STX5
LinkDB
Position
11:complement(71905031..71961363)
AA seq 918 aa
MWMSKTWLVQAFFIFITTESIGKLLDPCGHISPESPVIQLGSNFTAVCVLKEKCMDNFHV
NANYIVWKINHFTVPKEQYAILNRTASSVTFTNITALSVQLTCNILTFGQIEQNVYGITV
ISGLPPEKPKNLNCIVYEGKKMMCQWDPGRETYLETNFTLKSEWATEKFADCQTKRATPT
TCIVDYSPVYFVNIEVWVEAENALGKVSSNHINFDPVDKVKPSPPRNLSVSNSEELSSIL
KLSWINPNIKSVIRLKYNIQYRIKDDSTWNQIPPEDTSTTRSSFTVQDLQPFTEYVFRMR
CMKEDGKGFWSDWSEEASGITYEDRPSKAPSFWYKIDPSHTNGYRSVQLIWKTLSPFETN
GRILDYEVTLTRWKSRLQNYTVNDTKLTVNLTNDRYIATLTARNLVGKSDPSVLTIPACD
FQATRPVMDLKAFPKDNKLWVEWTAPNESVRKYILEWCVLSDKLPCILDWQQEDGTTHRT
YLRGNLVESKCYLITVTPVYADGPGRPESIKAYLKQAPPSQGPMVRTKKVGKNEAVLEWD
QLPVDVQNGFIRNYTIFYKTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMVAYTDEGG
KDGPEFTFTTPKFAQGEIEAIVVPVCLAILFTTLLGVLFCFNKRDLIKKHIWPNVPDPSK
SHIAQWSPPTPPRHNFNSKDQMYSDSNFTDVSVVEIEPNDKKPLPDDLKSLDLFRKEKSG
TEGHSSGIGGSSCMSSSRPSISSGDENESAQNTSSTVQYSTVVHSGYRHQVPSVQVFSRS
ESTQPLLDSEERPEDLQLIDNVDSGDNILPRQQYFKQNCSQQETSPDISQFERSKPASAV
SEEDFVRHRQQQISDMVQSSGSGQLKGFQEVSAADAFGPGVEGQGERFETVGVAAVIDEG
MPKSYLPQTVRQGGYVPQ
NT seq 2757 nt   +upstreamnt  +downstreamnt
atgtggatgtcgaagacgtggttagtgcaagccttctttatttttatcaccactgaatcc
ataggtaaacttctagatccatgtggccatatctccccggagtctccagttatacagctt
ggttctaatttcacagcagtttgtgtgctaaaggaaaaatgtatggataattttcatgta
aatgctaattacattgtctggaaaataaaccattttactgttcctaaggaacagtatgcc
atcttaaacagaacagcatccagtgtcacctttacaaatataacggcattaagtgttcag
ctaacttgcaacattcttacattcggacagattgaacagaatgtttatggaatcacagta
atttcaggattgcctccagaaaaaccaaaaaacttgaattgcattgtgtatgagggtaag
aaaatgatgtgtcagtgggatcctggcagggaaacatacctagaaacaaacttcacttta
aaatctgaatgggcaacagagaagtttgctgattgccaaacaaagcgtgccacgcctacc
acatgcattgttgattattctcctgtgtattttgtcaacattgaagtctgggtagaagct
gagaatgcccttgggaaggtttcatcaaatcatattaattttgatcctgtagataaagtg
aagcccagtccaccacgcaatttatcagtgagcaattcagaggaactgtccagtatctta
aagttatcatggatcaatccgaatattaagagtgtaataagactgaaatataacattcag
tatcggatcaaagatgactcaacttggaaccagattccccctgaagatacatcaactacc
agatcttcattcactgtccaggaccttcagccttttacagagtatgtatttaggatgcgc
tgtatgaaggaagatggtaaaggattctggagtgactggagtgaagaagcaagtgggatc
acgtatgaagatagaccatccaaagcaccaagtttctggtataagatagatccatcccat
actaatggctatcgatctgtacaactcatatggaagacattatctccttttgaaaccaac
ggaaggatcttggattatgaagtgaccctcacgagatggaaatcacgtttgcaaaattac
acagttaatgacacaaaactgacagtaaatcttacgaatgatcgttatatagctactcta
acagcaagaaatctggttggcaaatcagatccatctgttttaactatccctgcctgtgac
tttcaagctactcgtcctgtaatggatcttaaagcattcccaaaagataacaagctttgg
gtagagtggactgctccaaatgaatctgtaaggaaatacatacttgagtggtgtgtgtta
tccgataaattgccctgtatcctggactggcaacaagaagatggtaccacacatcgcaca
tatttaagagggaaccttgtggagagcaaatgttatttgataacagtcactccagtatat
gcagatggcccaggaagaccagaatctataaaggcataccttaaacaagcaccaccttcc
caaggacctatggttcggacaaagaaagtggggaaaaacgaagctgtcctagaatgggac
caacttcctgttgatgttcagaatggatttatcagaaattatactatattttataaaacc
atcattggaaatgagactgcggtgaacgtggattcttcccacacagaatataccctgtcc
tctctgactagtgacacgttgtacatggtacgaatggtagcatacacagatgaaggcgga
aaggatggtccagaattcacatttactacaccaaagtttgctcaaggagaaatcgaagcc
atagttgtgcctgtttgcttagcaatcctcttcacaactcttctgggagtgttgttctgc
tttaataaaagagacctcattaaaaaacacatctggcctaatgttccagatccttctaag
agtcacattgcccagtggtcacctcccacacctccaaggcacaattttaattctaaagat
cagatgtattcagatagcaatttcactgatgtaagtgttgtggagatagaacccaatgac
aagaagcctctcccagacgatctgaagtccctggacctgttcaggaaggagaagagcggc
accgaagggcacagcagtggcatcgggggctcttcctgcatgtcatcttcgaggccgagc
atttccagcggtgatgagaatgaatctgcacaaaatacctccagcactgtccagtattcc
acggtggtgcacagcggctacagacaccaggtgccgtcagtccaagtcttctcaagatcc
gaatccacccagcccttgctggattcagaagagcggccggaagatctacagttaatagat
aatgtagatagtggtgataacattttgcccagacaacagtatttcaaacagaactgcagc
caacaagaaaccagtccagatatttcccaatttgaaaggtcaaagcctgcttcagcagtc
agtgaggaagattttgttagacacagacagcagcagatttcggatatggtgcagtcctct
gggtctgggcaactgaaaggatttcaggaagtttctgcagcggatgcttttggtccaggt
gttgagggacaaggagaaagatttgaaaccgttggggtggcagctgtgattgatgaagga
atgcctaaaagttacttaccacagactgtacgacaaggcggctacgtgcctcagtga

DBGET integrated database retrieval system