KEGG   Oryctolagus cuniculus (rabbit): 100350940
Entry
100350940         CDS       T03373                                 
Symbol
SLIT1
Name
(RefSeq) slit guidance ligand 1
  KO
K06838  slit 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100350940 (SLIT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100350940 (SLIT1)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   100350940 (SLIT1)
SSDB
Motif
Pfam: LRR_8 LRR_5 LRR_4 EGF Laminin_G_2 Laminin_G_1 LRRNT hEGF LRRCT LRR_9 LRR_1 EGF_2 EGF_3 Laminin_G_3
Other DBs
NCBI-GeneID: 100350940
NCBI-ProteinID: XP_017203945
Ensembl: ENSOCUG00000003676
LinkDB
Position
18:complement(45269563..45439166)
AA seq 1530 aa
MALTAQRGSRPELWLLLLWAAACLPGASACPALCTCSGTTVDCHGTGLQAVPKNIPRSTE
RLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLHTL
PELLFQNNQALSRLDLSENAIQSIPRKAFRGATDLKNLQLDKNQISCIEEGAFRALRGLE
VLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGLFTQCAG
PASLRGLNVAEVQKNEFSCSGQGEAGRVPTCTLSSGSCPAMCTCSNGIVDCRGKGLTAIP
ANLPETMTEIRLELNGIQSIPPGAFSPYRKLRRIDLSNNHISEIAPDAFQGLRSLNSLVL
YGNKITDLPRGVFSGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSLARGT
FTSLRAIQTLHLAQNPFICDCSLKWLADFLRTNPIETSGARCASPRRLANKRIGQIKSKK
FRCSAKEQYFIPGTEDYQLNSECNSDVVCPHKCRCEASVVECSSLKLTKIPERIPQSTAE
LRLNNNEIAILEATGMFKKLTHLKKINLSNNKVSEIEDGAFEGAASVSELHLTANQLESI
RSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNHITTIAPGAFDTLQALS
TLNLLANPFNCDCQLAWLGDWLRKRRVVTGNPRCQNPDFLRQIPLQDVAFPDFRCEEGQE
EGGCLPRPQCPQECACLDTVVRCSNKHLRALPVGIPKNVTELYLDGNQFTQVPGQLSTFK
FLQLVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLHGNDV
ATLQEGTFTDVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPPHMEGKLL
LTTPAKKFECQGPPTLAVQAKCDPCLSSPCQNQGTCHNDVLERYRCTCASGYKGRDCEVS
SDSCFSSPCGNGGTCQAQEGEDAGFTCSCPTGFEGPTCGVNADDCVEHACANGGVCVDGV
GNYTCQCPLQYVGRTCEQLVDFCSPGLNPCQHEAQCVGTPDGPRCECAPGYAGDNCSENQ
DDCRDHRCQNGAQCVDEVNSYTCVCAEGYSGQLCEIPSQPPAPRSPCEGTECQNGANCVD
QGSRPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQNWPRANITLQVSTAEDNGILL
YNGDNDHIAVELYQGHVRVSYDPGSYPSSAIYSTETINDGQFHTVELVTFDQMVNLSIDG
GSPMTMDNFGKHYTLNSEAPLYVGGMPVDVNSAAFRLWQILNGTSFHGCIRNLYINNELQ
DFTKTQMKPGVVPGCEPCRKLYCLHGICQPDATPGPVCHCDAGWGGVHCDQPADGPCLGH
KCVHGKCVPLDALSYSCQCQEGYSGALCNQAGAPAEPCGGLQCLHGHCQASAAKGAHCVC
DPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVECRGSCPGSGCCRGLRLK
RRKLTFECSDGTSFAEEVEKPTKCGCALCA
NT seq 4593 nt   +upstreamnt  +downstreamnt
atggcgctgacggcacagcgtgggtcccggccggagctctggctgctgctgctgtgggca
gccgcgtgcctcccgggtgcctcggcgtgccccgccctctgcacctgcagcggcaccacg
gtggactgccacggcacggggctgcaggccgtccccaagaacatcccgcggagcaccgag
cgcctggaactcaatggcaacaacatcacccggatccacaagaacgacttcgcgggcctc
aagcagctgcgggtgctgcagctgatggagaaccagatcggggccgtggagcggggggct
tttgatgacatgaaggagctggagcggcttcggctgaaccggaaccagctgcacacgctc
ccagaactgctgttccagaataaccaggctctgtcgcgactggacctgagtgagaacgcc
atccagtccatccccaggaaagctttccggggcgccaccgacctcaagaatttacagctg
gacaagaaccagatcagctgcattgaggagggggccttccgggctctgcgggggctggag
gtgctgaccctgaacaacaacaacatcaccaccattcccgtgtccagcttcaaccacatg
cccaagcttcggaccttccgcctgcactccaaccacctgttctgcgactgccacctggcc
tggctctcgcagtggctgaggcagcggccgaccatcgggctgttcacccagtgcgcgggc
cccgccagcctgcgcggcctcaatgtggccgaggtccagaagaatgagttcagctgctca
ggccagggggaggcggggcgcgtgcccacctgcaccctctcctccggctcctgcccggcc
atgtgcacctgcagtaatggcatcgtggactgtcgcggcaaaggcctcaccgccatccct
gccaacctgcccgagaccatgacagagatccgcctggagctcaatggcatccagtccatc
cccccgggagccttctctccctacagaaagctgcggaggatagacctgagcaacaaccac
atctccgagatcgcgcccgacgccttccagggcctgcgctccctgaactcgctggtcctc
tatgggaacaagatcacagacctcccccgcggtgtgttttcaggcctgtacaccctacag
ctcctcctcctgaatgccaacaagatcaactgcatccggcctgacgccttccaggatctg
cagaacctctcgctgctctccctgtatgacaacaaaatccagagtcttgccaggggcacc
ttcacctcgctgcgggccatccagacgctgcacctggcccagaaccctttcatctgcgac
tgtagcctcaagtggctggcggacttcctgcgcaccaaccccattgagacgagcggggcc
cgctgcgccagcccccggcgcctcgccaacaagcgcatcgggcagatcaagagcaagaag
ttccggtgctcagccaaagagcagtacttcattccaggcacagaggactatcagctcaac
agtgagtgcaacagtgacgtcgtctgtccccacaagtgccgctgcgaggccagcgtggtg
gagtgctccagcctgaagctcaccaagattcctgagcgcatcccgcagtccacggccgag
ctacggctgaacaacaatgagatcgccatcctcgaggccacggggatgttcaagaaactc
acacatctgaagaaaatcaacctgagcaacaacaaggtgtctgagatcgaagatggggcc
tttgagggtgcggcctccgtgagcgagctgcacctgacagccaaccagctggagtccatc
cgcagtggcatgttccgggggctggacggcctgaggaccctgatgctgaggaacaaccgc
atcagctgcatccacaatgacagcttcacgggcctgcgcaacgtccggctcctgtcgctg
tacgacaaccacatcaccaccatcgcccctggcgccttcgacaccctgcaggccctgtcc
acgctcaacctcctggccaaccctttcaactgcgactgccagctggcctggctgggcgac
tggctgcgcaagaggagggtcgtgacgggcaacccacggtgccagaacccggacttcctg
cggcagatccccctgcaggacgtggccttccctgacttccggtgcgaggaaggccaggag
gaggggggctgcctgccccgcccgcagtgcccccaggagtgcgcctgcctggacaccgtc
gtgcgatgcagcaacaaacacctgcgggccctgcccgtgggcatccccaagaacgtcaca
gaactctatttggacgggaaccagttcacgcaggttccaggccagctgtccaccttcaag
ttcctgcagctcgtggacctgagcaacaacaagatcagttccttgagcaattcctccttc
accaacatgagccagctgaccacgctgatcctcagctacaacgccttgcagtgcatccct
ccgctggccttccagggcctccgctccctgcgcctgctgtccctccacggcaacgacgtc
gccaccctccaagagggcaccttcacggacgtgacctccctgtctcacctggccattggc
gccaatcccctgtactgtgactgccacctccgttggctctccagctgggtgaagactggc
tataaggaacccggcattgcccgctgcgctgggcccccgcatatggagggcaagctgctc
ctcaccacgcccgccaagaagtttgaatgccaaggtcccccgaccctggctgtccaggcc
aagtgtgacccgtgcttgtccagcccctgccagaaccagggcacctgccacaacgacgtg
cttgagaggtacaggtgcacctgcgccagtggctataagggccgagactgtgaggtgtcc
tcggacagctgcttcagcagcccctgtgggaacggcggcacctgccaggcacaggagggc
gaggatgccggcttcacgtgctcctgtcccaccggcttcgaagggccaacctgtggggtg
aacgcagatgactgcgtggagcacgcctgtgctaatgggggtgtctgtgtggacggcgtg
ggcaactatacctgccagtgcccgctgcagtatgtgggcaggacctgtgagcagctggtg
gacttctgctcgccgggtctgaacccgtgtcagcacgaggcccagtgtgtgggcaccccg
gatgggcccaggtgtgagtgtgcaccaggttatgcaggtgacaactgcagtgagaaccag
gatgactgcagggatcatcgttgccagaatggggctcagtgtgtggatgaggtcaacagc
tacacctgtgtctgtgccgagggctacagcggacagctctgcgagatcccgtcccaaccc
cctgcacccaggagcccctgtgagggcactgagtgccagaacggggccaactgtgtggac
cagggcagccggcccgtgtgccagtgcctgccgggcttcggcggccctgagtgtgagaag
ttgctcagcgtcaacttcgtggaccgggacacctacctgcagttcaccgacctgcagaac
tggccacgcgccaacatcactctgcaggtctccacagcagaggacaatgggatcctgctg
tacaacggggacaacgaccacatcgcggttgagctgtaccagggccatgtgcgtgtcagc
tatgacccgggcagctaccccagctctgccatatacagcaccgagacgatcaacgatggg
cagttccacaccgtcgagctggtcacctttgaccagatggtgaatctctccatcgacggc
ggcagtcccatgaccatggacaacttcggcaagcactacacgctcaacagcgaggcgccc
ctctacgtgggagggatgcccgtggatgtgaactcggccgccttccgcctgtggcagatc
ctcaatggcaccagcttccacggttgcatccgaaacctgtacatcaacaacgagctgcag
gacttcaccaagacgcagatgaagccaggcgtggtgcccggctgcgagccctgccgcaag
ctctactgcctgcatggcatttgccagcccgatgccaccccggggcctgtgtgccactgc
gatgccggctgggggggcgtgcactgcgaccagccagccgacggcccctgccttggccac
aagtgtgtccatggaaaatgtgtgcccctcgacgctctttcctacagctgccaatgccag
gaggggtactcgggggccctgtgcaaccaggccggggccccggcagagccttgcgggggt
ctgcagtgcctgcatggccactgccaggcctcggccgccaagggggctcactgtgtgtgt
gaccctggcttttcaggcgagctgtgtgagcaagagtccgagtgccggggggaccctgtc
cgggactttcaccaggtccagaggggctatgccatctgccagaccacgcgccccctgtcg
tgggtggagtgccggggctcgtgcccaggctcgggctgctgccggggcctgcggctgaag
cggaggaagctcaccttcgagtgcagcgacgggacctcttttgccgaggaggtggagaag
cccaccaagtgcggctgcgccctgtgcgcgtag

DBGET integrated database retrieval system