KEGG   Oryctolagus cuniculus (rabbit): 100352056
Entry
100352056         CDS       T03373                                 
Symbol
PAK1
Name
(RefSeq) p21 (RAC1) activated kinase 1
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04360  Axon guidance
ocu04392  Hippo signaling pathway - multiple species
ocu04510  Focal adhesion
ocu04625  C-type lectin receptor signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04660  T cell receptor signaling pathway
ocu04666  Fc gamma R-mediated phagocytosis
ocu04810  Regulation of actin cytoskeleton
ocu05132  Salmonella infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05205  Proteoglycans in cancer
ocu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100352056 (PAK1)
   04012 ErbB signaling pathway
    100352056 (PAK1)
   04014 Ras signaling pathway
    100352056 (PAK1)
   04392 Hippo signaling pathway - multiple species
    100352056 (PAK1)
   04024 cAMP signaling pathway
    100352056 (PAK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100352056 (PAK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100352056 (PAK1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100352056 (PAK1)
   04650 Natural killer cell mediated cytotoxicity
    100352056 (PAK1)
   04660 T cell receptor signaling pathway
    100352056 (PAK1)
   04666 Fc gamma R-mediated phagocytosis
    100352056 (PAK1)
   04062 Chemokine signaling pathway
    100352056 (PAK1)
  09158 Development and regeneration
   04360 Axon guidance
    100352056 (PAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100352056 (PAK1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100352056 (PAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100352056 (PAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100352056 (PAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100352056 (PAK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100352056 (PAK1)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100352056 (PAK1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100352056 (PAK1)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: STE group
  STE20 family
   100352056 (PAK1)
Membrane trafficking [BR:ocu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100352056 (PAK1)
 Endocytosis
  Macropinocytosis
   Kinases
    100352056 (PAK1)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100352056 (PAK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD ABC1 Kinase-like Pkinase_fungal DSHCT APH Kdo
Other DBs
NCBI-GeneID: 100352056
NCBI-ProteinID: XP_017199968
Ensembl: ENSOCUG00000010538
UniProt: G1TLL9
LinkDB
Position
1:139220747..139414205
AA seq 544 aa
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSTEDYNSSNTLNVKTVSETPAVPPVSEDEDDE
DDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEK
QKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQM
NLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCM
DEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKR
STMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGT
PELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEAT
KNNH
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgtcaaataacggcctagacattcaagacaaacccccggcccctccgatgagaaacacc
agcactatgattggagcaggcagcaaagatgctggaaccctgaaccatggttccaaacct
ctacccccaaacccagaggagaagaagaagaaggaccgcttttaccgatccatcttacct
ggagataaaacaaataaaaagaaggaaaaggagcggccagaaatttctcttccttcagat
tttgagcacacaattcacgttggttttgatgctgtcacaggggagtttacgggaatgcca
gagcagtgggcccgcttgcttcagacatcaaatattactaagtcggaacagaagaaaaac
ccgcaggctgttctggatgtgttagaattttacaactcaaagaagacctccaacagccag
aagtacatgagctttacagataaatctactgaggattataattcttctaacactttgaat
gtgaagactgtgtctgagactcctgcagtgccaccagtttcagaagatgaagatgatgaa
gatgatgctactccacctccagtgattgctccacgtccagagcacacaaaatctgtatac
acacgttctgtgattgaaccactgcctgttaccccaactcgggatgtggctacatctccc
atttcacctactgagaataataccactccaccggatgctttgacccggaatactgaaaag
cagaagaagaagcctaaaatgtctgatgaggagatcttggagaaattacgaagcatagtg
agtgtgggcgatcctaagaagaaatatactcggtttgagaagattggacaaggtgcttca
ggcaccgtatacactgcaatggatgtagccacaggacaggaggtggccattaagcagatg
aacctgcagcagcagccaaagaaagagctgattattaatgagatcctggtcatgagggaa
aacaagaacccaaatattgtgaactacttggacagttatcttgtgggggatgagctgtgg
gtcgtcatggaatacttggctggaggctccttgacagatgtggtgacagaaacctgtatg
gatgaaggccagattgcagctgtgtgccgtgagtgtttgcaggctctggagtttctgcat
tcgaaccaggtcatacacagagacatcaagagtgacaatattctattgggaatggatggc
tctgtcaagctaactgattttggattctgtgcacaaataactccagagcagagcaaacgg
agcaccatggtgggaaccccatactggatggcaccggaggttgtgacacggaaggcctat
gggcccaaggttgacatctggtccctgggcatcatggcgattgaaatgattgaaggggag
cctccatacctcaatgaaaaccctctaagagccttgtacctcattgccaccaatggaacc
ccagagcttcagaacccagagaagctgtcggctattttccgggactttctgaaccgctgt
ctcgagatggatgtggagaagagaggttcagcaaaagagctgctacagcatcaattcctg
aagattgccaagcccctctccagcctcactccactgatcgctgcagcaaaggaggcaacc
aagaacaatcactaa

DBGET integrated database retrieval system