Oryctolagus cuniculus (rabbit): 100352306 Help Entry 100352306         CDS       T03373                                  Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu03008   Ribosome biogenesis in eukaryotes ocu03013   Nucleocytoplasmic transport ocu03250   Viral life cycle - HIV-1 ocu05166   Human T-cell leukemia virus 1 infection Brite KEGG Orthology (KO) [BR:ocu00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     100352306    03008 Ribosome biogenesis in eukaryotes     100352306   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     100352306  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100352306  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ocu03019]     100352306    03009 Ribosome biogenesis [BR:ocu03009]     100352306    03016 Transfer RNA biogenesis [BR:ocu03016]     100352306    03036 Chromosome and associated proteins [BR:ocu03036]     100352306   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100352306    04031 GTP-binding proteins [BR:ocu04031]     100352306 Messenger RNA biogenesis [BR:ocu03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      100352306 Ribosome biogenesis [BR:ocu03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     100352306   Pre-60S particles     100352306 Transfer RNA biogenesis [BR:ocu03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     100352306 Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      100352306    Spindle formation proteins     100352306 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100352306 GTP-binding proteins [BR:ocu04031]  Small (monomeric) G-proteins   Ran Family    Ran     100352306 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Motif Other DBs NCBI-GeneID:  100352306 NCBI-ProteinID:  XP_008248637 Ensembl:  ENSOCUG00000026506 UniProt:  G1TFL3 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYD ISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTA LPDEDDDL NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtttgatgtgacatccagagtgacctacaagaacgtgcccaactggcacagagacctg gtgcgcgtgtgtgaaaacatccccatcgtgctgtgtggcaacaaagtggacattaaggac aggaaagttaaggcaaagtccattgtcttccaccgaaagaagaaccttcagtactatgat atttcggccaaaagtaactacaactttgaaaagcccttcctctggcttgctagaaagctc attggagaccccaacttggagttcgtcgccatgcccgctcttgccccaccagaggtggtc atggacccggccttggcggcgcagtatgagcacgacttagaggttgctcagacgactgct ctccccgacgaggacgatgacctgtga

DBGET integrated database retrieval system