KEGG   Oryctolagus cuniculus (rabbit): 100352900
Entry
100352900         CDS       T03373                                 
Symbol
NR1H3, LXR-alpha
Name
(RefSeq) nuclear receptor subfamily 1 group H member 3
  KO
K08536  liver X receptor alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03320  PPAR signaling pathway
ocu04931  Insulin resistance
ocu04932  Non-alcoholic fatty liver disease
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100352900 (NR1H3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100352900 (NR1H3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100352900 (NR1H3)
   04931 Insulin resistance
    100352900 (NR1H3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100352900 (NR1H3)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ocu03310]
    100352900 (NR1H3)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    100352900 (NR1H3)
Nuclear receptors [BR:ocu03310]
 1. Thyroid hormone like
  1H. Liver X receptor like receptor
   100352900 (NR1H3)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100352900
NCBI-ProteinID: NP_001171885
Ensembl: ENSOCUG00000002095
UniProt: D5MS64
LinkDB
Position
1:186607590..186616369
AA seq 447 aa
MSLWLEAPVPDVSPDSAVELWEPRAQDASSQAQAASSCTLKDEARTPQSAGSALGAGLEA
AEPTALLPRVEAPAEPTELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK
RQEEEQAQAAAGPPRAPSPPQALPQLSPEQLGMIEKLVAAQQQCNQRSFSDQLRVTPWPM
APDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgtccctgtggctggaggcccctgtgcctgatgtttctcctgactctgccgtggagctg
tgggagccacgtgcacaagatgcaagcagccaggcgcaagcagccagcagctgtaccctc
aaggacgaagccaggacaccccaatctgctggcagtgccttgggggcggggctggaggca
gcagagcccacagccctgctccccagggtggaggcccccgcagagcccacagagctccgt
ccacaaaagcggaagaaggggccagccccgaagatgctggggaacgagctgtgcagcgtg
tgtggggacaaggcctccggcttccactacaacgtgctgagctgcgagggctgcaaaggc
ttcttccgccgaagcgtcatcaagggcgcgcgttacgtctgccacagcggcggccactgc
cccatggacacctacatgcggcgcaagtgccaggagtgtcggctccgcaagtgtcgccag
gctggcatgcgggaggagtgtgtcctgtcagaagagcagatccgcctgaagaaactgaag
cgacaggaggaggagcaggcgcaggccgcggccgggccccctcgtgccccctcgcctccc
caggccctgccccagctcagcccggagcagctgggcatgatcgagaagctggtggccgcc
cagcagcagtgtaaccagcgctccttttctgaccagcttcgagtcacgccttggcccatg
gccccagatccccatagccgggaggcccgccagcagcgctttgcccacttcaccgagctg
gccatcgtgtccgtgcaggagatcgtggattttgccaaacagctgcccggcttcctgcag
ctcagccgggaggaccaaatcgccctgctgaagacctctgcgattgaggtgatgctgctg
gagacgtctcgcaggtacaaccctgggagtgagagcatcaccttcctcaaggatttcagc
tacaaccgggaggactttgccaaagcagggctgcaagtggagttcatcaaccccatcttc
gagttctccagagccatgaatgagctgcagctcaatgatgccgagttcgccttgctcatt
gccatcagcatcttctctgcagaccggcccaacgtgcaggaccagctccaggtagagagg
ctgcaacacacatatgtggaggccctgcatgcctacgtctccatccaccacccccatgac
cggctgatgttcccgcggatgctgatgaaactggtgagcctccggacactgagcagcgtc
cactcggagcaagtgtttgcactgcgcctgcaggacaaaaagctgccccctctgctgtct
gagatctgggatgtacacgaatga

DBGET integrated database retrieval system