KEGG   Oryctolagus cuniculus (rabbit): 100352905
Entry
100352905         CDS       T03373                                 
Symbol
IL1R1
Name
(RefSeq) interleukin 1 receptor type 1
  KO
K04386  interleukin 1 receptor type I
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04064  NF-kappa B signaling pathway
ocu04380  Osteoclast differentiation
ocu04640  Hematopoietic cell lineage
ocu04659  Th17 cell differentiation
ocu04750  Inflammatory mediator regulation of TRP channels
ocu05146  Amoebiasis
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100352905 (IL1R1)
   04064 NF-kappa B signaling pathway
    100352905 (IL1R1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100352905 (IL1R1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100352905 (IL1R1)
   04659 Th17 cell differentiation
    100352905 (IL1R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100352905 (IL1R1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100352905 (IL1R1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100352905 (IL1R1)
   05163 Human cytomegalovirus infection
    100352905 (IL1R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100352905 (IL1R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100352905 (IL1R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100352905 (IL1R1)
   04090 CD molecules [BR:ocu04090]
    100352905 (IL1R1)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL1 receptor family
   100352905 (IL1R1)
CD molecules [BR:ocu04090]
 Proteins
  100352905 (IL1R1)
SSDB
Motif
Pfam: TIR Ig_3 Ig_2 I-set ig Ig_6 TIR_2
Other DBs
NCBI-GeneID: 100352905
NCBI-ProteinID: XP_002709930
Ensembl: ENSOCUG00000006957
LinkDB
Position
2:complement(90252494..90333554)
AA seq 576 aa
MKENMNVLLRLVCVVALLISLEADNCKEREEAIIIVSSANEIGVRACPINQNERIGTIHW
YKNDSEIPISTERDGSIHQHKDNLWFVPAKAEHSGRYYCVVRNATSCLKVGITTKFVENE
PNLCYNTQALFQQRLPVAGDGGLVCPYMDFFKDENNNFPKIQWYKDCKPLVLDNVHFSGV
TDKLIVMNVTETHRGNYTCRASYTYLGKQYPVSRVIEFITLEENKPQKPVIMSPANETME
VVLGSQIQLICNVTGQYSDAVYWKWNGSGIDDEDPLLEEEYKFLENPSCKKRSTQLAMLN
ILEVESRFYLYPFICLAKNTYGLNVAYIKLIPPVPDFQKHTIGICVMLTVLIMCSVFIYK
IFKVDIVLWYRDSCYDFLPKKAPDGKTYDAYILYPKTLTGESTSNSDIFVFKVLPEVLEK
QFGYKLFIYGRDDYVGEDIVEVTNEHIKKSRRLIVILVRETSNFTWLGGSSEEQIAMYNA
LIQDGIKVMLLELEKIHNYEKMPESIKFIKQKHGAIRWSGDFKEGPQSAKTRFWKNVRYH
MPVQRQVPSSSRQFLATASNPDTKKKLQREIHLPLG
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgaaggagaatatgaatgtgttgctcaggcttgtttgtgtcgtagccctgctgatttcc
ctggaggctgataactgcaaggaacgtgaagaagcaattattatagtatcatctgcaaat
gaaataggtgttcgcgcctgtcctattaaccaaaatgaaaggattggcactatacattgg
tataagaatgatagtgaaatccctatatctacggaacgagatggtagcatccatcaacac
aaagataacctttggtttgttcctgctaaggcagagcactcagggcgttactactgtgta
gtaagaaatgcaacttcctgcctcaaagttggaatcactacaaaatttgtggagaatgaa
cctaatttgtgttataacacacaagctctcttccaacagagactacccgttgctggagat
ggaggacttgtgtgcccttacatggattttttcaaagatgaaaataacaattttcccaaa
atacagtggtataaggattgcaaacctctagttcttgacaatgtacacttctccggagtc
acagataagctcattgtgatgaatgtgactgaaacgcatagagggaactacacttgtcgc
gcatcctacacgtacctgggaaagcagtatcctgtgagccgggtaatagaattcattact
ctagaggaaaacaagccccaaaagccagtgattatgagtccagctaatgagacaatggaa
gtggtcttgggatctcagatacaactgatctgcaacgtgactgggcagtacagtgatgct
gtttactggaagtggaatgggtcgggaattgatgatgaggatccactactggaagaagaa
tataaattcttggaaaatccttcatgtaaaaaacgaagtacgcaactcgcaatgctcaac
attttagaagtggaaagtagattttatctatatccatttatttgtttagccaagaacaca
tatggtttaaatgtagcatacatcaaattaatacctccagtccctgatttccagaagcac
acaattgggatatgtgtcatgttaacagtgctaattatgtgctctgttttcatatataaa
atcttcaaagttgacattgtactctggtacagggattcctgctatgatttcctcccaaag
aaagctccagatggaaagacctatgatgcatacatactatatccaaagaccctcacagga
gagtccacctctaactcagatatttttgtgtttaaagtcttgcctgaagtcttggaaaaa
caatttgggtataagctgttcatttatggcagggatgactatgttggggaagacattgtt
gaggtcactaatgaacatataaagaaaagcagaagactgattgtgattttagtgagagag
acctcaaacttcacctggctgggtgggtcatcggaagagcagatagccatgtacaacgcc
ctcattcaggatggaattaaggttatgctgctggagctggagaagatccacaactacgag
aagatgccagaatccattaaattcattaagcagaagcatggggccatccgctggtcgggg
gacttcaaagaggggccacagtccgccaagaccaggttctggaaaaacgttcggtatcac
atgcctgtccagcggcaggtgccttcatccagtcgccagtttctggccacagcctctaac
ccagacactaagaagaaactgcaaagagaaattcacttgcctcttggctaa

DBGET integrated database retrieval system