KEGG   Oryctolagus cuniculus (rabbit): 100352965
Entry
100352965         CDS       T03373                                 
Symbol
RIPK1
Name
(RefSeq) receptor interacting serine/threonine kinase 1
  KO
K02861  receptor-interacting serine/threonine-protein kinase 1 [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04064  NF-kappa B signaling pathway
ocu04210  Apoptosis
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04668  TNF signaling pathway
ocu04936  Alcoholic liver disease
ocu05132  Salmonella infection
ocu05160  Hepatitis C
ocu05163  Human cytomegalovirus infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100352965 (RIPK1)
   04668 TNF signaling pathway
    100352965 (RIPK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100352965 (RIPK1)
   04217 Necroptosis
    100352965 (RIPK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100352965 (RIPK1)
   04621 NOD-like receptor signaling pathway
    100352965 (RIPK1)
   04622 RIG-I-like receptor signaling pathway
    100352965 (RIPK1)
   04623 Cytosolic DNA-sensing pathway
    100352965 (RIPK1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100352965 (RIPK1)
   05160 Hepatitis C
    100352965 (RIPK1)
   05163 Human cytomegalovirus infection
    100352965 (RIPK1)
   05169 Epstein-Barr virus infection
    100352965 (RIPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100352965 (RIPK1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100352965 (RIPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100352965 (RIPK1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100352965 (RIPK1)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   100352965 (RIPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Death RIO1 ABC1 RHIM Kdo Kinase-like
Other DBs
NCBI-GeneID: 100352965
NCBI-ProteinID: XP_017205996
Ensembl: ENSOCUG00000011791
LinkDB
Position
Un
AA seq 676 aa
MSLDDIKMKSSDFLEKADLDSGGFGEVSLCFHRLHGLVILKKVYTGPKRAEYNESLLEEG
RMMHRLKHSRVVELLGVVMEEGNYCLVMEYMEKGSLMHVLKAEISIPLSVKGRIIAETIE
GMCYLHGEGVIHKDLKPENILVDNDFHIKIADLGVASFKTWSKLTKEEHNEQRKVNSTRK
KTGGTLCYMAPEHLNDVNAKPTEKSDVYSFAIVLWAVLANKEPYENAICEQQLILCIKSG
NRPDVDDVAEDCPGELIRLMELCWEADPRARPTFPDIEERFRPFYSSHYEEFVEEDVKSL
KKRYPEQSAVVKRMQSLQLDCVPVPPSRSNSAHYNVDRSLPATEQPSSLHSSQGFMTGPV
EVSFFSACPEISQEENEPSLQSKLQEEANYHLYGSRMDKQTRQPPRQSVAYSREEERRRR
VSYDPFAQQTPYENVQKTGIKVHSYPGTTSHSNAAHQPTGLTSQPQLPYWNNGVYSLHGF
GTRPLEPGTAGQAVWYGPSLSPMSSLYKTPVPETNLLGNTPTIPFSSLSPAEESMKCSIY
NSSGIQLGACNYMEIGGISSPPLECLCTNLQEPASKYQAIFDDTTSLTDKHLSPVRDNLG
KHWKNCARKLGLTESQIDEIDHDYERDGLKEKVYQMLQKWLMREGTKGATVGKLARALHQ
CSRQDLLTCLIQLSQK
NT seq 2031 nt   +upstreamnt  +downstreamnt
atgtctttggatgacattaaaatgaagtccagtgacttcctggagaaggcggatctggac
agcggcggcttcggggaggtgtctctgtgcttccacagactccacggcttagtgatcctg
aagaaggtgtacacagggcccaagcgtgccgagtacaacgagtctctgctcgaggagggg
aggatgatgcacaggctgaagcacagccgggtggtggagctcctgggcgtcgtcatggaa
gaggggaactactgcctggtgatggagtacatggagaagggcagcctgatgcacgtgctc
aaagccgagatcagtatcccgctttctgtaaaaggaaggatcattgcagagaccatcgaa
gggatgtgctacctgcacggagaaggtgtgattcacaaggacctgaagcccgagaacatc
ctcgtcgacaacgacttccacattaagatcgccgaccttggcgttgcttcctttaagacg
tggagcaaactgactaaagaggaacacaacgagcagaggaaagtgaatagcacccgcaag
aaaactggcggcaccctgtgctacatggcccccgagcacctgaatgacgtcaacgcgaag
cccacggagaagtcggacgtgtacagctttgccatcgtactctgggcagtccttgccaat
aaggagccgtacgaaaatgccatctgtgagcagcagctgattctctgcataaagtccggc
aaccggcccgacgtggacgacgtcgccgaggactgccccggggagctcatccgcctcatg
gagctctgctgggaggcggacccgagagcgcggcccacgttccctgatattgaagaaaga
tttagaccgttttattcaagtcattacgaggaattcgtagaagaggatgtgaagagctta
aagaagcggtatccggagcagagtgcagtcgtgaagagaatgcagtctctccagctggac
tgtgtgccagtgcctccgagcaggtcgaattcagcccattacaatgtggatcgttccctc
ccagccacggaacagcccagctccctgcacagttcccagggcttcatgacgggtccagtg
gaggtgtcctttttctctgcctgccctgagatctcgcaagaagagaatgagcccagcctg
cagagtaagctccaggaggaagccaactaccatctttacggcagccgcatggacaagcag
acgagacagccgcccaggcagagtgtggcctacagcagagaggaggagaggagacggagg
gtttcctatgacccttttgctcagcagacaccctatgaaaatgttcagaaaacaggaata
aaagtccacagttaccctggtacaaccagtcatagcaatgcagcacaccaaccaacagga
ctaaccagccaaccccaactgccatattggaacaatggagtctacagtctacatggtttt
ggaacaaggcctttggagccgggaacagcaggtcaagcagtttggtatgggccaagtcta
agcccaatgtcaagtctgtataaaactccagtgcctgagaccaacctactaggaaacacg
cccaccattccattcagctccttgtcgccagcagaagagtctatgaaatgcagcatatac
aacagcagtggcattcagcttggagcctgtaactacatggagatcggcgggataagctca
ccaccactagaatgcttgtgcacaaacttacaggagccagcttctaagtaccaagccatc
tttgatgacaccacgagtctgacggacaaacacctgagccccgtcagggacaacctggga
aaacactggaaaaactgtgcccggaagctgggcctcaccgaatcgcagatcgacgagatt
gaccatgactatgagcgagacggactgaaagagaaggtttaccagatgctccagaagtgg
ctgatgcgggaaggcaccaagggggccaccgtggggaagctggcccgtgcgctgcaccag
tgttccagacaggatctcctcacctgtctgatacagctcagccagaagtag

DBGET integrated database retrieval system