Oryctolagus cuniculus (rabbit): 100353213 Help Entry 100353213         CDS       T03373                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu00510   N-Glycan biosynthesis ocu00513   Various types of N-glycan biosynthesis ocu04141   Protein processing in endoplasmic reticulum Module ocu_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:ocu00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     100353213    00513 Various types of N-glycan biosynthesis     100353213  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100353213 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  100353213 NCBI-ProteinID:  XP_002721065 Ensembl:  ENSOCUG00000003287 UniProt:  G1SJE2 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctcgaggccatgagcagatacaccagcccagtgaacccagccgtcttccctcat ctgaccgttgtgcttttggccattggcatgttcttcaccgcctggttcttcgtctacgag gtcacgtccaccaagtacactcgggacatctacaaagagctcctcatctccttggtggcc tcgctcttcatgggctttggagtcctcttcctcctgctgtgggttggcatctatgtctga

DBGET integrated database retrieval system