KEGG   Oryctolagus cuniculus (rabbit): 100353301
Entry
100353301         CDS       T03373                                 
Symbol
TRIM37
Name
(RefSeq) tripartite motif containing 37
  KO
K10608  tripartite motif-containing protein 37 [EC:2.3.2.27]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100353301 (TRIM37)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100353301 (TRIM37)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100353301 (TRIM37)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    100353301 (TRIM37)
SSDB
Motif
Pfam: zf-B_box MATH zf-C3HC4_3 HlyD_2 zf-C3HC4_2 MRFAP1 FUSC
Other DBs
NCBI-GeneID: 100353301
NCBI-ProteinID: XP_008269427
Ensembl: ENSOCUG00000002326
UniProt: G1SHB0
LinkDB
Position
19:29176767..29326063
AA seq 965 aa
MDEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQL
RELVNCRWAEEVTQQLDTLQLCSLTKHEENEKDKCENHHEKLSVFCWTCKKCICHQCALW
GGMHGGHTFKPLAEIYEQHVTKVNEEVAKLRRRLMELISLVQEVERNVEAVRNAKDERVR
EIRNSVEMMIARLDTQLKNKLITLMGQKTSLTQETELLESLLQEVEHQLRSCSKSELISK
SSEILMMFQQVHRKPMASFVTTPVPPDFTSELVPSYDSATFVLENFSTLRQRADPVYSPP
LQVSGLCWRLKVYPDGNGVVRGYYLSVFLELSAGLPETSKYEYRVEMVHQSCNDPTKNII
REFASDFEVGECWGYNRFFRLDLLANEGYLNRQNDTVILRFQVRSPTFFQKCRDQHWYIT
QLEGAQTSYIQQINNLKERLTIELSRTQKSRDLSPPDNHLSPQNDDTPDVRAKKSGSCSD
ILLKGGSTAACLREAKEDDEDEEKIQNEDYHHELSDGDLDLDLVGEDEVNHLDGSSSSAS
STATSNTEENDIDEETMSGENDVEYNTMELEEGELMEDAAAAGPPGSSHDYMGASSRMSR
RTHLCSAATSSLLDIDPLILIHLLDLKDRSSMENLWGLQPRPPASLLHPTASYSRKDKDQ
RKQQQAMWRVPSDLKMLKRLKTQMAEVRCMKTDVKNTLAEIKSSNVASGDMQTSLFSADQ
AALAACGSESSSRLQDLGMELLAKSSVASCYVRNSTNKKSNSPKPARSSIAGSLSLRRAV
DSGETCRSKGDCHTLSEGSPGSSQSGSRHSSPRALTHGIISDIVPKTEERQCKALDSRAV
VVAVFNGLPAIEKRRKMVTLGASAKGGRLEGLQVTDLENNSETEELQPVLPEGAAAAPEE
GMSSDSDIECDTENEEQEEHASMGGFNDSFMAQPPDEGTHSSFPDGEQIDPENLTFNTDE
NNGRG
NT seq 2898 nt   +upstreamnt  +downstreamnt
atggatgaacagagcgtggagagcattgctgaggttttccgatgtttcatttgtatggag
aaattgcgggatgcacgcctgtgtcctcattgctctaagctttgttgcttcagctgcatt
aggcgctggctgacagagcagagagctcagtgtcctcattgccgtgctccactacagctg
cgagaactggtaaactgtcgttgggctgaagaagtcacacaacagcttgatactcttcaa
ctctgcagtctcaccaaacatgaagaaaacgaaaaggacaagtgtgaaaatcaccatgag
aaacttagcgtattttgctggacttgtaagaagtgtatctgccatcagtgtgcactttgg
ggaggaatgcacggtgggcatacctttaaacctttggcagaaatttatgaacagcacgtc
actaaagtgaatgaagaggttgccaaacttcgtcgacgtcttatggaactgatcagctta
gttcaagaagtggaaagaaacgtagaagctgtaagaaatgcaaaagatgaacgtgttcgg
gaaattcggaattcagttgagatgatgattgcacggttagatacacagctgaagaataag
cttattacgttgatgggtcagaagacatctttaacacaagagacagaactgttggaatcc
ttacttcaagaagtagaacaccagttgcgatcttgtagtaagagtgagttaatatctaag
agctcagagattttaatgatgtttcagcaagttcatcgaaaacccatggcatcatttgtt
accactcctgtaccaccagattttaccagtgaattagtgccatcttatgattctgcaact
tttgttttagagaatttcagcactttacgccagagagcagatcctgtttacagtccacct
cttcaagtttcaggactttgctggaggttaaaagtttacccagatggaaatggagttgta
cgtggttactatttatctgtgtttctggaactctcagctggattgcctgaaacttctaaa
tatgaatatcgtgtagagatggttcaccagtcctgcaatgatcccaccaaaaacatcatt
cgagaatttgcatctgactttgaggttggagaatgctggggctataacagatttttccgt
ttggacttacttgcaaatgaaggatacttgaatcgacagaatgatacagtgatactaagg
tttcaggtacgttcacctacttttttccaaaaatgccgggaccaacactggtatattact
cagttggaaggtgcacaaacaagttacatacaacaaataaacaatcttaaagagagactt
accattgaactatctcgaactcagaaatcaagagatttatcaccaccagataatcatctt
agcccccaaaatgatgacactcctgatgttcgagctaagaagtctgggtcatgctctgac
attcttctcaaaggtggttctactgcagcttgtctaagagaggccaaagaggatgacgaa
gatgaggagaagattcaaaatgaagattaccatcatgagctttcagatggagatctggat
cttgatcttgttggtgaagatgaagtaaatcaccttgatggcagcagttcttctgctagt
tccacagcaacaagtaacacagaagaaaatgacattgatgaagaaactatgtctggagaa
aatgatgttgaatataacaccatggagttggaagagggagaactcatggaagatgcagct
gccgcaggacctccagggagtagccatgactacatgggtgccagcagcagaatgtcacga
agaacacatttgtgctctgctgccaccagtagtttattagacattgatcccctaatttta
attcatttattggaccttaaggaccggagcagcatggaaaatttatggggtttacagcct
cgcccacctgcctcacttttacaccctacagcatcatattctcgaaaagataaagatcaa
aggaagcagcagcaggcaatgtggcgagtgccatctgatttaaagatgctaaaaagactg
aaaactcaaatggctgaagttcgatgtatgaaaactgatgtaaagaatactcttgcagaa
ataaagagcagcaatgttgcttctggagatatgcagacaagccttttttctgctgatcag
gcagctctggctgcatgtggaagtgaaagctctagcagattacaggatttgggaatggag
ctcctggcaaagtcatcagttgccagttgttatgtacgaaactccacaaataagaagagt
aattcacctaagccagctcggtccagtatagcaggtagtctatcacttcgaagagcagtg
gactctggggaaacctgtcgttcaaagggagactgtcacactctatctgaaggctcccca
ggaagctctcagtctgggagcaggcacagttctccccgagccttgacacatggtattatc
agtgatattgtgcccaaaacagaagaacggcagtgtaaagctttggattcccgtgctgtt
gtggttgcagttttcaatggcctacctgctatagagaaaaggaggaaaatggttactttg
ggggctagtgctaaaggaggtcgcctggaaggattgcaggtgactgatttggaaaataat
tctgaaactgaagagttgcagcctgtgctacctgaaggagctgcagctgccccggaggaa
ggaatgagtagcgacagtgacattgaatgtgacactgagaatgaagagcaggaagagcac
gcgagcatgggtggattcaacgactctttcatggcacagcccccagatgaaggtacacat
tccagttttcctgatggtgaacaaatagatcctgaaaatctcaccttcaatactgatgaa
aacaatggaagaggctga

DBGET integrated database retrieval system