KEGG   Oryctolagus cuniculus (rabbit): 100354455
Entry
100354455         CDS       T03373                                 

Symbol
IKBKE
Name
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit epsilon
  KO
K07211  inhibitor of nuclear factor kappa-B kinase subunit epsilon [EC:2.7.11.10]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04936  Alcoholic liver disease
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05171  Coronavirus disease - COVID-19
ocu05207  Chemical carcinogenesis - receptor activation
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100354455 (IKBKE)
   04621 NOD-like receptor signaling pathway
    100354455 (IKBKE)
   04622 RIG-I-like receptor signaling pathway
    100354455 (IKBKE)
   04623 Cytosolic DNA-sensing pathway
    100354455 (IKBKE)
   04625 C-type lectin receptor signaling pathway
    100354455 (IKBKE)
   04657 IL-17 signaling pathway
    100354455 (IKBKE)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    100354455 (IKBKE)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100354455 (IKBKE)
   05160 Hepatitis C
    100354455 (IKBKE)
   05171 Coronavirus disease - COVID-19
    100354455 (IKBKE)
   05164 Influenza A
    100354455 (IKBKE)
   05162 Measles
    100354455 (IKBKE)
   05168 Herpes simplex virus 1 infection
    100354455 (IKBKE)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100354455 (IKBKE)
   05169 Epstein-Barr virus infection
    100354455 (IKBKE)
   05165 Human papillomavirus infection
    100354455 (IKBKE)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100354455 (IKBKE)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100354455 (IKBKE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100354455 (IKBKE)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100354455 (IKBKE)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100354455 (IKBKE)
SSDB
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD PK_Tyr_Ser-Thr ABC1 Pkinase_fungal Kinase-like APH DUF5798 ABATE
Other DBs
NCBI-GeneID: 100354455
NCBI-ProteinID: XP_017203317
LinkDB
Position
16
AA seq 711 aa
MQSTASYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTASYLRPREVQEREFEVLR
KLNHQNIVKLFAVEETGGSRQRVLVMEHCSGGSLLSVLESPENAFGLSEDEFLVVLRCVV
AGMNHLRENGVVHRDIKPGNIMRLVGHEGQSVYKLTDFGAARQLLDDEKFVSVYGTEEYL
HPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFVPYGGPRRNKEIMYRITTE
KPSGAIAGTQRRENGPLEWSYALPVTCRLSMGLQGQLVPILANILEVEPAKCWGFDQFFA
ETSDILQRVTVHVFSLSQAVLHHVYIHAHNTVAVFLEAVCEQTSVGPRQQEYFFEGHPCV
LEPSVSAQHIAHTTASSPLTLFSAASETPKGLAFRDPALDIPKFVPKVDLQADYNAAKGM
LGAGYQALRLARAMLHTQELMLRGLYWVVEVLQTTCRRTLEVTRTALLFLSSSLGTERLD
SAAETPTQQELQGATELRSRLRTLAEVLSRCSQNITETQAGLSRLGAELAKRRAQVHADR
STQQIQCCLDKMNLIYKQFKKSRMSPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECMH
KYQASLVAHGKWMREVHKTRNHLRLVGCSVAACNTEAQGAQESLSKILDQLLQDKAKGAQ
ALPPSTAPPAPQDLALHMQELCREMKLVAFDLQDNNRIIERLGKVTSVPDA
NT seq 2136 nt   +upstreamnt  +downstreamnt
atgcagagcacggccagctacctgtggcacacggatgacctgctggggcagggtgccact
gccagcgtgtacaaggcccgcaacaagaaatccggggagctggtggccgtgaaggtcttc
aacactgccagctacctgcgtccccgggaggtgcaggagagggagtttgaggtcctgcgg
aagttgaaccaccagaacatcgtcaagctcttcgcggtggaggagacggggggcagccgg
cagagggtgctggtgatggagcactgctctgggggcagcctgctgagtgtgctggagagc
ccggagaacgccttcgggctgtcggaggacgagttcctggtcgttctgcgctgtgtggtg
gccggcatgaaccacctgcgggagaacggcgtggtgcaccgcgacatcaagccgggcaac
atcatgcgcctggtgggccacgagggccagagcgtctacaagctcacggacttcggcgcc
gcgcgccagctgctggacgacgagaagttcgtctcggtctacggcaccgaggagtacctg
cacccggacatgtacgagcgggcggtgcttcgcaagccccagcaaaaggcgttcggggtg
accgtggacctctggagcatcggggtgaccctgtaccacgcagccaccggcagtctgccc
ttcgtgccctacggcgggccgcggcgcaacaaggagatcatgtaccggatcaccaccgag
aagccctccggggccatcgcgggcactcagcggcgggagaacgggcccctggagtggagc
tacgccctgccggtcacctgccggctgtccatgggcctgcagggccagctggtgcccatc
ctggccaacatcctggaggtggagccggccaagtgttggggcttcgaccagttcttcgcc
gagacaagcgacatcctgcagcgcgtcaccgtgcacgtcttctccctgtcccaggccgtg
ctgcaccacgtctacatccacgcccacaacacggtggccgtcttcctggaggccgtgtgc
gagcagaccagcgtgggcccccggcagcaggagtacttctttgagggccacccgtgcgtc
ctggagcccagcgtctcggctcagcacatcgcgcacacgactgccagcagccccctgacc
ctgttcagcgcggccagcgagacccccaaggggctggccttcagggaccctgccctggac
atccccaagttcgtccccaaagtggacctgcaggcagactacaatgccgccaagggcatg
ctgggtgccggctaccaggccctgcgcctggcacgggccatgctgcacacacaggagctg
atgcttcgcgggctgtactgggtcgtggaggtgctgcagaccacgtgcaggcggactctg
gaggtcacacggaccgcactcctcttccttagcagcagcctgggcactgagaggctggac
agcgcggctgagacgcccacgcagcaggagctgcagggggccacggagctgaggtccagg
ctgcggactctggccgaggtcctctccagatgttcccaaaatatcacggagacccaggcg
ggcctgagcaggctgggcgcggagctggcgaagaggcgggctcaggtacatgcggacaga
agcacccagcagatccagtgttgtctggacaagatgaacctcatctacaaacagttcaag
aagtctcggatgagcccagggcttggctataacgaggagcagatccacaagctggacaag
gtgaatttcagccacttggccaagaggctgctgcaggtgtttcaggaggagtgcatgcac
aagtaccaggcgtccctcgtcgcgcacggcaagtggatgagggaggtgcacaagaccagg
aaccacctgcgcctggtcggctgttccgtggctgcctgtaacacggaggcccagggtgcc
caggagagcctcagcaagatcctggaccaactcctgcaggataaagccaagggcgcccag
gccttgccaccctccacggctcctcctgcaccccaagacctggccctccacatgcaagaa
ctgtgccgtgagatgaagctggtggcctttgacctccaggacaacaatcgcatcatcgaa
cggttgggtaaggtcacatctgtgcctgatgcctga

DBGET integrated database retrieval system