KEGG   Oryctolagus cuniculus (rabbit): 100354655
Entry
100354655         CDS       T03373                                 
Symbol
ACKR3
Name
(RefSeq) atypical chemokine receptor 3
  KO
K04304  C-X-C chemokine receptor type 7 (atypical chemokine receptor 3)
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100354655 (ACKR3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100354655 (ACKR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100354655 (ACKR3)
   04050 Cytokine receptors [BR:ocu04050]
    100354655 (ACKR3)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    100354655 (ACKR3)
Cytokine receptors [BR:ocu04050]
 Chemokine receptors
  CXC Chemokine
   100354655 (ACKR3)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 100354655
NCBI-ProteinID: XP_002723286
LinkDB
Position
Un
AA seq 363 aa
MDLHLFDYAEPGNFSDVVWPCNSSGDCIAVDTVQCPGLANKSVLLYTLALVYIFIFVIGM
IANSVVVWVNVQAKTTGYDTHCYILNLAIADLWVVITIPVWVVSLVQHNQWPMGELTCKV
THLIFSINLFGSIFFLTCMSVDRYLSVTRFAGTSSCRKQRVRRGVCVLVWLLAFCVSLPD
TYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSVIAVFYFLLARAI
AASGDQEKQSSRKIIFSYVVVFLVCWLPYHVVVLLDIFSILHYLPFTCQLENALFTALHV
TQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSEAEYSALEQ
SAK
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggatctgcatctcttcgactacgcggaacccggcaacttctccgacgtcgtgtggccc
tgcaacagcagcggcgactgcatcgcggtggacacggtgcagtgccccggcctggccaac
aagagcgtcctgctgtacacgctcgccttggtctacatcttcatcttcgtcatcggcatg
atcgccaactccgtggtggtctgggtgaacgtccaggccaagaccacgggctacgacacg
cactgctacatcctgaacctggccatcgcggacctgtgggtggtcatcaccatccccgtc
tgggtggtcagcctggtgcagcacaatcagtggcccatgggcgagctcacctgcaaggtc
acccacctcatcttctccatcaacctcttcggcagcatcttcttcctcacctgcatgagc
gtggaccgctacctgtccgtcacccgcttcgccggcacctcgagctgccggaagcagagg
gtgcgccgtggcgtctgcgtcctcgtgtggctgctggccttctgcgtgtccctgcccgac
acctactacctgaagaccgtcacgtccgcctccaacaacgagacctactgccggtccttc
taccccgagcacagcatcaaggagtggctcatcggcatggagctggtctccgtcgtcctg
ggcttcgccgtccccttctccgtcatcgccgtcttctacttcctgctcgccagagccatc
gcggcgtcgggcgaccaggagaagcagagcagccgcaagatcatcttctcctacgtggtg
gtcttcctggtgtgctggctgccctaccacgtggtcgtgctgctggacatcttctccatc
ctgcactacctgcccttcacgtgccagctggagaacgcgctcttcacggcgctgcacgtg
acgcagtgcctgtccctggtgcactgctgcgtcaaccccgtgctctacagcttcatcaac
cgcaactacaggtacgagctcatgaaggccttcatcttcaagtactcggccaagacgggg
ctcaccaagctcatcgacgcctccagggtgtccgaggcagagtactcggcgctggagcag
agcgccaagtga

DBGET integrated database retrieval system