KEGG   Oryctolagus cuniculus (rabbit): 100355367
Entry
100355367         CDS       T03373                                 
Symbol
ATF2
Name
(RefSeq) activating transcription factor 2
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04211  Longevity regulating pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04668  TNF signaling pathway
ocu04714  Thermogenesis
ocu04728  Dopaminergic synapse
ocu04911  Insulin secretion
ocu04915  Estrogen signaling pathway
ocu04918  Thyroid hormone synthesis
ocu04922  Glucagon signaling pathway
ocu04925  Aldosterone synthesis and secretion
ocu04926  Relaxin signaling pathway
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu05020  Prion disease
ocu05030  Cocaine addiction
ocu05031  Amphetamine addiction
ocu05034  Alcoholism
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05203  Viral carcinogenesis
ocu05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100355367 (ATF2)
   04668 TNF signaling pathway
    100355367 (ATF2)
   04022 cGMP-PKG signaling pathway
    100355367 (ATF2)
   04151 PI3K-Akt signaling pathway
    100355367 (ATF2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100355367 (ATF2)
   04922 Glucagon signaling pathway
    100355367 (ATF2)
   04915 Estrogen signaling pathway
    100355367 (ATF2)
   04926 Relaxin signaling pathway
    100355367 (ATF2)
   04935 Growth hormone synthesis, secretion and action
    100355367 (ATF2)
   04918 Thyroid hormone synthesis
    100355367 (ATF2)
   04928 Parathyroid hormone synthesis, secretion and action
    100355367 (ATF2)
   04925 Aldosterone synthesis and secretion
    100355367 (ATF2)
   04927 Cortisol synthesis and secretion
    100355367 (ATF2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100355367 (ATF2)
  09156 Nervous system
   04728 Dopaminergic synapse
    100355367 (ATF2)
  09149 Aging
   04211 Longevity regulating pathway
    100355367 (ATF2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100355367 (ATF2)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    100355367 (ATF2)
   05203 Viral carcinogenesis
    100355367 (ATF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100355367 (ATF2)
   05161 Hepatitis B
    100355367 (ATF2)
   05163 Human cytomegalovirus infection
    100355367 (ATF2)
  09164 Neurodegenerative disease
   05020 Prion disease
    100355367 (ATF2)
  09165 Substance dependence
   05030 Cocaine addiction
    100355367 (ATF2)
   05031 Amphetamine addiction
    100355367 (ATF2)
   05034 Alcoholism
    100355367 (ATF2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100355367 (ATF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100355367 (ATF2)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    100355367 (ATF2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2 Herpes_UL16
Other DBs
NCBI-GeneID: 100355367
NCBI-ProteinID: XP_008256994
Ensembl: ENSOCUG00000012156
LinkDB
Position
7:complement(114708452..114815057)
AA seq 505 aa
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQNTSGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDLSVPSSPHTEAIQHSSVSTSNGVSSTSKADVGATSVLTPM
ADQSTEPALSQIVMAPSSQSQPSGS
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaaattcaaattacatgtgaattctgccaggcaatacaaggacctgtggaatatgagt
gatgacaaaccctttctatgcactgcccctggatgtggccagcgttttaccaacgaggat
catttggctgtccataaacataaacatgagatgacactgaaatttggtccagcacgtaat
gacagtgtcattgtggctgatcagaccccaactccaacaagattcttgaaaaactgtgaa
gaagtgggtttgtttaatgagttggcaagtccatttgagaatgaattcaagaaagcttca
gaagacgacattaaaaaaatgcctctagatttatcccctcttgcaacacccatcataaga
agtaaaattgaggagccttctgttgtagaaacaactcaccaggatagtcctttacctcac
ccagagtctactaccagtgatgaaaaggaggtaccattggcacaaactgcacagcccaca
tcagctattgttcgtccagcatcattacaggttcccaatgtgctgcttacaagttctgat
tcaagtgtaattattcagcaggcagtaccttcaccaacctcaagtactgtaatcacccag
gcaccatcctccaataggccaattgttcctgtgccaggcccatttcctcttctattgcat
cttcctaatggacaaaccatgcctgttgctattcctgcatcaattacaagttctaatgta
catgttccagctgcagtcccacttgttcgaccagtcaccatggtgcctagtgttccagga
atcccaggtccttcttcccctcaaccagtgcagtcagaagcaaaaatgagattaaaggcg
gctttgacccagcagcatcctccagttaccaatggtgatactgtcaaaggtcatggtagc
ggattggttaggactcagtcagaggaatctcgaccacagtcgttgcaacagccagccaca
tctacaacagaaactccggcctctccagctcatacaactccacagacccaaaatacaagc
ggtcgtcgaagaagagcagctaacgaagatcctgatgagaaaaggagaaagtttctagag
cgaaatagagcagcagcttcaagatgccgacaaaaaaggaaagtctgggttcagtcttta
gagaagaaagcggaagacttgagttcattaaatggtcagctgcagagtgaagtcaccctg
ctgagaaatgaagtggcacagctgaaacagcttcttctggctcataaagattgccctgta
accgccatgcagaagaaatctggctatcatactgctgataaagacgatagttcagaagac
ctttcagtgccgagcagtccacatacagaagcaatacagcatagttctgtcagcacatcc
aatggggtcagttccacctccaaagcagacgtgggagccacttcagtcctcaccccgatg
gcggaccagagcacggagcctgcgctgtcgcagattgtcatggctccttcctcccagtca
cagccctcaggaagttga

DBGET integrated database retrieval system