KEGG   Oryctolagus cuniculus (rabbit): 100355411
Entry
100355411         CDS       T03373                                 
Symbol
BMP15
Name
(RefSeq) bone morphogenetic protein 15
  KO
K05498  bone morphogenetic protein 15
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100355411 (BMP15)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100355411 (BMP15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100355411 (BMP15)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100355411 (BMP15)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 100355411
NCBI-ProteinID: NP_001186046
Ensembl: ENSOCUG00000001641
UniProt: G1TV82
LinkDB
Position
Un
AA seq 393 aa
MALLSILRALLLWGLVIFMEHRVQAAKVGQSSIALLAEAPTLPLIRELLEEAPDKQQRKP
QLQGHPLRYMLELYQRSADPHGHPRENRTIGATMVRLVRPLANVARPLRGPWHIKTLDFP
LRPNRVAYQLVKATVVYRHQLHLAHFRLSCHVEPWVQKSPTNHLPPGRGSAKPSLMSKAW
MEMDITQHIQQRLWNHKGRRVLRLRYMCQQQKGSEVLEFQWPSTSSLDIAFLLLYFNDTH
RSIQKAKAPSRGLEEFMERDSPLLRRTRQAGSIASEVPGSSRVHDGTENNQCSLHPFQVS
FRQLGWDHWIIAPHLYTPNYCKGVCPRVLRYGLNSPNHAIIQNLVNELVDQSVPQPSCVP
YKYVPISILLIEANGSILYKEYEDMIAQSCTCR
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggccctcctcagcatcctgagagcccttcttctttggggactggtgatttttatggag
cacagagttcaagcagccaaggtggggcagtcttctattgccctcctggctgaggcccct
accttgcctctgattcgggagctgctagaagaagcccctgacaagcagcagaggaagcca
cagctccaagggcatcccctgcgatacatgttggagttgtaccagcgttcggctgaccct
cacgggcacccaagggagaaccgcaccattggagccaccatggtgaggctggtaaggccc
ttggctaatgtggcaaggccgctacgaggtccctggcatataaagaccctggactttcct
ctgagaccaaaccgggtagcgtaccaactagtaaaagccacggtggtttaccgccatcaa
ctccaccttgctcacttccgtctctcctgccacgtggagccctgggtccagaaaagccca
accaaccaccttcctccaggaagaggctctgcaaaaccttctctgatgtctaaagcttgg
atggagatggatatcacacaacacattcagcaaaggctctggaaccacaaggggcgcaga
gtgctacgactgcgctacatgtgtcagcagcaaaaagggagtgaagttctagagttccag
tggcccagcacgtcatccttggacattgccttcctgttactctatttcaatgacactcac
agaagcattcagaaggccaaagctccctccagaggcctggaggagtttatggaaagggac
tctcctcttctgcggaggacccggcaagcaggcagtatcgcatctgaggttcctggctct
tctcgggtacatgatgggactgaaaacaaccagtgttctctccaccccttccaagtgagc
ttccgccagctgggctgggatcactggatcattgctcctcatctctacacgccaaactac
tgtaagggggtctgtcctcgggtgctgcgctatggtctcaattcccctaatcatgccatc
attcagaaccttgtcaatgagctggtggaccagagtgttcctcaaccctcctgtgtccct
tataagtatgttcccattagcatcctgctcattgaggcaaatgggagtattttgtacaag
gagtatgaggatatgattgcccagtcctgcacatgtcggtga

DBGET integrated database retrieval system