KEGG   Oryctolagus cuniculus (rabbit): 100356068
Entry
100356068         CDS       T03373                                 
Symbol
GH1, GHB1, gh
Name
(RefSeq) somatotropin
  KO
K05438  growth hormone
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04080  Neuroactive ligand-receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100356068 (GH1)
   04151 PI3K-Akt signaling pathway
    100356068 (GH1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100356068 (GH1)
   04060 Cytokine-cytokine receptor interaction
    100356068 (GH1)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100356068 (GH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100356068 (GH1)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  CSF and other factors
   100356068 (GH1)
SSDB
Motif
Pfam: Hormone_1 DUF5798
Other DBs
NCBI-GeneID: 100356068
NCBI-ProteinID: NP_001316004
Ensembl: ENSOCUG00000004341
UniProt: P46407 A0A0M6L0P7
LinkDB
Position
19:complement(48725704..48726965)
AA seq 216 aa
MAAGSWTAGLLAFALLCLPWPQEASAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERA
YIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDMELLRFSLLLIQSWLGPVQFLSR
AFTNTLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRVGQLLKQTYDKFDTNLRGDDAL
LKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCVF
NT seq 651 nt   +upstreamnt  +downstreamnt
atggctgcaggctcttggaccgcaggcctcctggctttcgccctgctctgcctgccctgg
cctcaggaggccagcgccttcccagccatgcccttgtccagcctgtttgccaacgccgtg
ctccgcgcccagcacctgcaccagctggctgctgacacctacaaagagtttgagcgcgcc
tacatcccggaggggcagcgctactccatccagaacgcccaggctgccttctgcttctca
gagaccatcccggcccccacgggcaaagacgaggcccagcagagatcggacatggagctg
ctccgcttctcgctgctgctcatccagtcctggctggggcccgtgcagttcctcagcagg
gccttcaccaacaccctggtgtttggcacctcggaccgcgtctacgagaagttgaaggac
ctggaggaaggcatccaagccctgatgcgggagctggaagacggcagcccccgggttggg
cagctcctcaagcaaacctacgacaagtttgacacaaacctgcgcggcgacgacgcactg
ctcaagaactacgggctgctgtcctgcttcaagaaggacctgcacaaggctgagacctac
ctgcgggtgatgaagtgtcgccgcttcgtggagagcagctgcgtcttctag

DBGET integrated database retrieval system