KEGG   Oryctolagus cuniculus (rabbit): 100356105
Entry
100356105         CDS       T03373                                 
Symbol
ESPL1
Name
(RefSeq) extra spindle pole bodies like 1, separase
  KO
K02365  separase [EC:3.4.22.49]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100356105 (ESPL1)
   04114 Oocyte meiosis
    100356105 (ESPL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100356105 (ESPL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100356105 (ESPL1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100356105 (ESPL1)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     100356105 (ESPL1)
Peptidases and inhibitors [BR:ocu01002]
 Cysteine peptidases
  Family C50: separase family
   100356105 (ESPL1)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    100356105 (ESPL1)
SSDB
Motif
Pfam: Peptidase_C50 CHAT
Other DBs
NCBI-GeneID: 100356105
NCBI-ProteinID: XP_008254731
Ensembl: ENSOCUG00000011244
UniProt: G1T0Y4
LinkDB
Position
4:37100607..37123345
AA seq 2108 aa
MRSLKGADFGALLSSQKGAAELLPDLKEFLSKPPAGFPSCRSDAERRQVCDAILRACNQQ
LTAKLTCPGHLESLLALAELACDGYVASTPQRPPLYLERILYILLRNVAAQGNPEATLRL
SQPLHACLMQCSRQAAPQDYEAVARGSFSLLWKGAEGLLARQAAVSARLRALSFLALLED
GSTPCEVPHFASATACRVVAAHQLFDASGHGLNEADAEFLGELLSRHVIRSLVGEQQASP
GPLSPQRALCLLELTLEHCRRLCWSRHHDKAAGAVAKAQGYLRSTSLAPSLQLCQLGIQL
LRAGEEGPQAAAALLTNASAVLRNSLQTPSPPLRALYESCQFFLSGLERGTKRRYGANAL
LSLFAFLGEYRSLIRQLRDGDVCRDSPKQQQSLLQTHFQGLHLYTVVVYDFAQGCQEADL
AELAQLVESCRSLVVWMLEALEGLSGQELSDYVGMTASDTSNLAYSFYCHKLYSEACAIS
EPLCQRLGLAKPGTYPNVPPEKLHRCFRLHVESLKKLGKQAQGCKMVTLWLAALQPCSSE
HMTEPVTFWVRVKMDAARAGDKELQLKTLRDSLSGWGPEPLALLLREELQAYKAVRADTG
QERFNIICDLLELSPDETPAGAWARATHLVELAQVLCYHDFAQQTNCSALDAIQEALQLL
EAVRPDAQDEARLLDDKAQALLWLYICTLEAKMQEGIERDRRAQAPNNLEEFEVNDLNYE
EKLQEDRFLYSNIAFNLVADAAQSKCLDQALALWKEVLTKGQAPAVRCLQQTAASLHILV
ALYQLVAKPLQALEALLLLRIACVTLGDHAKATGSSCHLAQLLLTLGCPSYAQLYLEEAE
SSLKHLDPSSDTHLLLSLTCAVLRSQLSWARQEVTEGISLLLSVLGNPALQKSSKAWYLL
RAQSLQLVAVYLSLSSNSLSDTLREQLWAQGWQTPETALMDSHKLLRSIVLLLLGSDVLS
VQKGAVETAFLDYGENLVQKWQVLAEVLSCSEKLVCRLGRLGSVNEAKAFCLEALKLTTK
LQIPRQCALFLVLKAELELARSDVDLCQSDLQQVLFLLESCTEFGGVAQHPDPTKKIHLQ
KGKQQARAPRAPVPLEEELFLRGPALELVATVAKEPGPVAPSANSSPVLKTKPQPSPGFL
SHGAACDCLLCASPVLSAVCLRWVLVTAGVRLAAGHQAQGVDLLQLVLKGCPAASERLSR
ALQAALNQKAPPSPVPSLSDEILAQAYTQLALEGLKQLSSKSLGKVFELGLKFVAVRIHQ
LEPWRANLLLIQALAKLAGLNCCTTQLFANSWGWQPPLAKSPPGSEPSKTQSHKHSGRGR
QQSAPAPVPLHNAAQKGLESGGAPCTPKPPGRVRPAGPRVPFTVFEEVHHTESKPEVPQA
PRVQRRVQTRLKVNFSDDSDLEDPVSAEAQLAEEPKRRGTSSRGRGRGQARKGPGSKTNA
LLAPDSAPGLSGRTRRAKKAALRPHEEQGPEVMRTIPEEELADHTLELSFEILRGSDGED
SASGEKAQAPRPDAAIGECEVLRRDSNKEELPVLCPDKESAKELGPRIRQPSGPVAIGLS
ALDSLCDSLSVAFRGISHCPPSGLYAHLCRFLALCLGHRDPYATACLVAESVSITCRHQL
LTHLHRQLSKAQKHRGALEVAEQLQGLSLQERPGDAPLGRVQRLFSFKPSGSSHFPQPEK
EHFRERLALLPSGVTVCVLALATLQPGTVGDTLLLTRLEKDIPPVTMQIPTAHCKLPLSS
ALKEFDAIQKEQKENSSCTDKREWWTGRLELDQRMEALIASLEKAVLGCWRGLLLPVAEG
PSLAQEAALLLEPLQECGWKYPDPTLLKVLLSGAGTLTPQDVQALAAGLCPTQPERAREL
LSAAVGRLQGQTVPSSRHLVLVLDKDLQKLPWESMPCLRALPVTRLPSFRFLLSYSIIKE
SGASSVLSHGVDPRSTFYVLNPHNNLSSTEEQFRANFSSEVGWRGVVGEVPSPEQVQRAL
TEHDLYIYAGHGAGARFLDGQAVLRLSCRAVALLFGCSSAALAVHGNLEGAGIVLKYIMA
GCPLFLGNLWDVTDRDIDRYTEALLQGWLGAGPGAPLLYYVSQARQAPRLKYLIGAAPVA
YGLPVSLR
NT seq 6327 nt   +upstreamnt  +downstreamnt
atgaggagcctcaaaggagccgacttcggggccctgctgagcagccagaagggagctgcg
gagttgctgcctgacttgaaggagttcctgtccaagcctccagctggttttccaagctgt
cgatcagatgctgagaggagacaagtttgtgatgccatcctaagggcttgcaaccagcag
ctgacggccaagctgacttgccctgggcacctggagagcctgctggcgctggcagagcta
gcttgtgatggctacgtggcatcgaccccccagcgccctcccctctacctggaacgaatt
ctttacatcttactgcggaacgttgctgcacagggaaacccggaggccacgctccgtctc
tcccagcccctccatgcctgcttgatgcagtgttcccgccaagctgcaccccaagactat
gaggccgtggctcgaggcagcttctctctgctttggaagggagcggaaggcctgctggca
cggcaggctgcggtttccgctcggctaagagccttgagcttcctggcgctcttggaggat
ggaagtactccttgtgaggttcctcacttcgcctcggccacagcctgccgagtagttgct
gcccatcagctctttgatgccagtggacatggtctgaacgaggcggatgcggagttcctg
ggtgagctgctctccaggcatgtgatcagatccttggtgggtgagcaacaggcctctcct
ggtcctctctctccccagagggccctctgcctcttggagctcaccttggaacactgccgg
cgcctctgctggagccgccaccatgacaaggctgccggtgcggtggcgaaggctcagggt
tacctcaggagcaccagtctggctcccagtctccagctgtgccagctggggatccagctg
ctgcgggctggggaggaggggccccaggcagcggccgcgcttctgaccaacgcgtccgcc
gtcctgaggaacagtctgcagaccccgtcgcccccgctgcgcgccctgtacgagagctgt
cagttctttctgtcgggcctggagcgaggcaccaagaggcgctacggagccaatgctctt
ctgagcttatttgcttttcttggagagtaccgctcccttatccggcagctgcgggatggt
gatgtgtgtagggactcccccaagcagcagcagtccttgcttcagacgcactttcagggc
cttcacctctacactgtggtggtctacgacttcgcccaaggctgtcaggaggctgacttg
gctgagctggcccagctcgtggagagctgcagatctctcgtcgtctggatgctggaagcc
ttagaggggctgtcaggccaagagctgtctgactacgtggggatgactgcctcagacacc
agtaacctggcctacagcttctactgtcacaagctctactctgaggcctgtgccatctcg
gagccactgtgtcagcgcctgggcctggcaaagccaggcacttatcccaacgtgcctcct
gaaaagttgcacaggtgcttccggctgcatgtggagagtttgaagaaactgggtaaacag
gcccagggctgcaagatggtgaccttgtggctggcagccctgcagccctgcagctctgaa
cacatgactgagccagtcactttctgggttcgggtcaagatggacgcggccagggccgga
gacaaggagctgcagcttaagactctgcgagacagcctgagcggctggggcccggagccc
ctggccctcctgctgagggaggagctgcaggcttacaaggcggtgcgggccgacactggg
caggagcgcttcaacatcatctgtgacctgctggagctgagccccgatgagacgccggct
ggggcctgggcacgagccacccacctcgtggagctggctcaggtgctctgctaccacgac
tttgcccagcagaccaactgttcagccctggatgccatccaggaagccctgcagctcctg
gaggctgtgcggcccgatgcccaggacgaggctcggctcctggacgataaagcgcaggcc
ttgctgtggctctacatttgtaccctggaggccaagatgcaggaaggcattgagcgggat
cggagagcccaggcccccaacaacctggaggaattcgaagtcaacgacctgaactacgaa
gagaagctccaggaagaccgttttctctacagtaacatcgccttcaacctggtcgcagat
gccgcgcagtccaagtgcctggaccaagccctggccctgtggaaggaggtgctcacaaag
gggcaggcccccgccgtgcggtgtctccagcagaccgcggcctcgctgcacatcctcgtg
gccctgtatcaactggtggcgaagcccctgcaggctctcgaggccctcctgcttctgcgg
atcgcctgtgtgacactgggggaccacgcgaaggcgactggctcctcctgccacctcgcc
cagctcctcctgaccctcggctgccctagctatgcccagctgtacctggaagaggcagag
tcaagcctgaagcacctggatccaagcagcgacacgcacctgctcctctccctgacctgt
gctgtgctgcgcagccagctctcctgggctcgccaggaggtgactgagggcatctccctg
ctgctgtccgtccttgggaatcccgccctccagaagtcatccaaggcgtggtacttgctg
cgtgcccagtccctgcagctggtggctgtctacctcagcctctcctccaacagcctctcc
gacaccctgcgggagcagctctgggcccaaggctggcagacgcccgagacggcgctcatg
gactcccacaaactgctccggagcattgtcctgctgctgctgggcagcgacgtgctctcc
gttcagaaaggagccgtggagacagcgttcctggactacggggagaatctggtacagaag
tggcaggtcctcgcggaggtgctaagctgctcggagaagctggtctgccgcctgggccgc
ctggggagtgtgaatgaagctaaggccttctgcctggaggccctgaaactcaccacaaag
ctgcagataccacgccagtgtgccctgttcctggtgctgaaggccgagctggagctggcc
cgcagtgacgtcgacctctgtcagtcggacctgcagcaggtgctcttcctgctcgagtcc
tgcacagagtttgggggggtggcccagcacccagaccccacgaagaagatccacctgcag
aaagggaagcagcaggcccgggcaccccgtgctccagtgcccttggaggaggagctcttc
ctcagaggccctgcgctcgagctggtggccacggtcgccaaggagccgggccccgttgcg
ccttctgccaactcctcaccggttctgaagaccaagccccagcccagccccggcttcctc
tcccacggcgctgcctgtgactgcctgctctgcgccagccctgtgctctcagcggtctgt
ctgcgctgggtgttggtcacagcaggggtgaggctggctgcgggccatcaggcccagggt
gtggatctgctgcagctggtactgaagggctgccctgcggcctccgagcgcctcagccgc
gcgctccaagccgccttgaatcagaaagcgcccccgtcccccgtccccagcctctcggat
gagatcttggctcaggcctacacacagctggcactggagggcctgaagcagctgtcgagc
aaaagtctggggaaggtgttcgagttggggctgaagtttgtggcagtgcggatacaccag
ctggagccctggcgagccaacctgctcctgattcaggcccttgcaaagctagccggtctc
aactgctgcactacccagctttttgcaaactcctggggctggcagccacccttagctaaa
agtcccccgggctcagagccttctaagactcagagccacaaacattctggacgggggcgc
cagcagtcagcccctgctcccgtgcccctccataatgccgctcagaaaggcctggaaagt
ggaggagcaccctgtacacctaagcctccaggccgggtccggccagctggcccccgggtt
cctttcactgtgtttgaggaagtccaccatacagagagcaagcccgaagttccccaggcc
cccagggtacaacggagagtgcagacgcgcctcaaggtgaacttcagcgatgacagtgac
ttggaagaccctgtctctgccgaggcacagctggcagaagagcctaagagacggggcacc
tcttcccggggcaggggccggggccaggctcggaagggcccgggctcgaagacgaatgcc
ctgcttgccccagatagtgcccctggtctgagtggcaggacccggagggccaagaaagcg
gccttgagaccgcatgaggagcagggccccgaggtcatgaggaccattcctgaggaggag
ctggctgaccacaccttggaactgagcttcgagatcctgcggggctccgacggggaagac
tcggcctcaggtgagaaggcacaggccccaaggcctgatgcagccatcggggaatgtgag
gtgctaaggcgagactccaacaaggaggagctgcccgtcctgtgcccggacaaggagagc
gcaaaggaacttggtccccggatccgacagccctcaggccctgtagccattggtctctcc
gccctggactccctgtgtgactccctgagcgtcgcattccgtgggatcagtcactgccct
cccagtgggctttatgcccacctctgccgcttcctggccttgtgcttggggcaccgggac
ccctatgccactgcctgccttgttgctgagtctgtctccatcacctgtcgccaccagctg
ctcacccacctccacagacagctcagcaaggcccagaagcatcggggagccctggaagta
gcggagcagctacagggcctgagcctccaggagaggcctggagacgcccccctgggccgc
gtccagcgcctcttctccttcaagccttcaggctccagccacttccctcagccggagaag
gagcactttcgggagcgcctggcactgctccccagtggggtgacggtgtgtgtgttggcc
ctggccacactccagcctggaactgtgggcgataccctcctgctgacccggttggaaaag
gacatccccccagtcaccatgcagatccccaccgcccactgcaagcttcctctgagttca
gccctgaaagagttcgacgcgatccagaaggagcagaaagagaacagcagctgcacggac
aagcgggagtggtggacggggcggctggagctggaccagcggatggaggctctcatcgct
tccctcgagaaggccgtgctgggctgctggagggggctgctgctgccggtcgcggagggg
cccagcctcgcccaggaggccgccctcctgctggagccactgcaggagtgtggctggaaa
tacccggaccccactctgctgaaagtcctgctcagcggggccggcaccctcaccccacag
gacgttcaggctctggccgctgggctgtgcccaacccagccggagcgagcccgggagctc
ctgagtgcggccgtaggacgtctacagggccagactgtcccgagcagcaggcaccttgtg
ttggtgctagacaaggacctgcagaagctgccgtgggagagcatgccctgcctccgggcc
ctgccggtcacccggctgccctccttccgcttcctgctgagctactccatcatcaaagag
tccggggcctcatccgtgctgagccatggggtggatcctcgaagcaccttctatgtcctg
aaccctcacaacaacctgtccagcacagaggagcagtttcgagccaattttagcagtgaa
gtgggctggagaggggtcgtcggggaggtgccgagccccgaacaggtgcagagagccctg
acagagcatgacctgtacatctacgcaggtcacggggccggggcccgcttcctggacggg
caggctgtcctgcggctgagctgccgggcggtggccctgctgttcggctgcagcagcgca
gccctggctgtgcacggaaacctggagggggctggcatcgtgctcaagtacatcatggct
ggctgccccttgttcctgggtaatctctgggatgtgacagaccgcgacatcgaccgctac
acggaggctctgttgcagggctggctgggagcaggccccggggcccccctactctactac
gtcagccaggcccgccaggctccccgactcaagtatctcatcggggccgcgcctgtagcc
tacggcctgcctgtctccctacggtaa

DBGET integrated database retrieval system