KEGG   Oryctolagus cuniculus (rabbit): 100356594
Entry
100356594         CDS       T03373                                 
Symbol
NOD2
Name
(RefSeq) nucleotide binding oligomerization domain containing 2
  KO
K10165  nucleotide-binding oligomerization domain-containing protein 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04621  NOD-like receptor signaling pathway
ocu04668  TNF signaling pathway
ocu05152  Tuberculosis
ocu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100356594 (NOD2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100356594 (NOD2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100356594 (NOD2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100356594 (NOD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ocu04054]
    100356594 (NOD2)
Pattern recognition receptors [BR:ocu04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   100356594 (NOD2)
SSDB
Motif
Pfam: NACHT CARD NLRC4_HD2 LRR_6 NOD2_WH LRR_8 AAA_16 AAA_29 AAA_25 NB-ARC AAA_30 AAA_22 G-alpha ABC_tran DAP3
Other DBs
NCBI-GeneID: 100356594
NCBI-ProteinID: XP_008273264
Ensembl: ENSOCUG00000012840
UniProt: G1T469
Structure
LinkDB
Position
Un
AA seq 1013 aa
MCSQEAFQAQRSQLVGLLVSGSLEGFESILDLLLSWEVLSWEDYEGLRLVGQPLSHLARR
LLDTVWNKGTWGCQKLIAAVQEAQDSSQCPELHGCWDPHSLHPAQDLQSHRPAIVRRLYS
HVEGVLDLALEQGFISQYECDEIRLPIFTSSQRARRLLDLATVKANGLAAFLLQHVQKLP
VSLSLPFEAAACKKYMSKLRTIVAAQSRFLSTYDGAENLCLEDIYTENTLEVRTEVGMAG
PLHKSPAALGLEELFSPNGHLNEDADTVLVVGEAGSGKSTLLQQVHLLWATGQDFQEFLF
VFPFSCRQLQCVARPLSVMTLLFEHCCWPDVGQQDVFQFLLDHPDRILLTFDGFDEFKFK
FTDHERHCSPTDPTSVQTLLFNLLQGNLLKNARKVLTSRPDAVSAFLRKYVRTEFNLKGF
SEEGIELYLRKCHREPGVADRLIHLLQTTSALHGLCHLPVFSWMVSKCHQELLLQDGGSP
KTTTDMYLLILQHFLRHASLPDSASQGLGPSLLQGRLPTLLRLGQLALWGLGMCCYVFSA
QQLQAAQVDPDDISLGFLVQAQGVVPGSTAPLEFLHITFQCFLAAFYLVLSTDVPTASLR
YLFNCRRPGSSPLSRLLPRLCVQGSEHKESTVAALLQKTEPHNLQITAAFLAGLLSREHR
DLLAACQASERSLLRRRACARWCLARSLHKHFRSIPPAVPGEAKSMHAMPGFLWLIRSLY
EMQEERLAQEAVRGLNVEHLKLTFCGVGPAECAALAFVLRHLRRPVALQLDHNSVGDIGV
EQLLPCLGACKALYLRDNNISDRGICKLIEHALHCEQLQKLALFNNKLTDGCAHSVAQLL
ACKQNFLALRLGNNHITAEGAQVLAEGLRDNSSLQFLGFWGNKVGDKGAQALAEALSDHQ
SLKWLSLVGNNIGSVGAQALASMLEKNVALEELCLEENHLQDAGVCSLAEGLKRNSSLKV
LKLSNNCITFVGAEALLQALASNDTILEVWLRGNPFSPEEMEALSHRDSRLLL
NT seq 3042 nt   +upstreamnt  +downstreamnt
atgtgctctcaagaggctttccaggcacagaggagccagctggtggggctgctggtttcg
gggtccctggagggcttcgagagcatcctggacttgctgctgtcatgggaagttctctcc
tgggaggactatgagggcctccgcctcgtgggccagcctctgtcccacttggccaggcgc
ctcctggacactgtctggaataaaggcacttggggctgtcagaagctcatcgcagctgtc
caggaggcccaggacagcagccagtgccctgagctgcatggctgctgggacccccactca
ctccacccagcccaggacctgcagagtcaccggccagccatcgtcaggagactgtacagc
cacgtggagggcgtgctggacctggcgctggagcagggcttcatcagccagtacgaatgt
gatgaaatcaggctgcccatcttcacgtcatcccagagggcaagaaggctgctcgatctt
gccacagtgaaggcaaatgggctggctgccttccttctgcaacatgttcagaagttgccg
gtctcactgtccctgccctttgaagctgccgcgtgtaagaagtacatgtccaagctgcgg
accatagtagctgcacagtctcgcttcctcagcacctatgatggagcagagaacctctgc
ctggaggacatatacacagagaacaccctggaggtccggaccgaggtgggcatggctgga
cccctgcacaagagccccgccgccctgggcctggaggagctcttcagccccaacggccac
cttaatgaagatgcggacaccgtgctcgtggtgggcgaggcaggcagtggcaagagcaca
ctcctacagcaggtgcacttgctgtgggccacggggcaggactttcaggaatttctcttt
gtcttcccattcagctgccggcagctgcagtgtgtggccagaccgctgtctgtaatgacg
ctgctctttgaacattgctgctggcccgatgttggccaacaggatgtcttccagttcctc
ctggaccaccctgaccgcatcctcttgacctttgacggctttgatgagttcaagttcaag
ttcacggaccatgagcgtcactgctctccaactgaccccacgtctgtccagactctgctc
ttcaaccttctgcaaggcaacctcctaaagaacgcccgcaaggtgctgaccagccgtccg
gatgcggtgtcagcgttccttaggaagtatgtccgcactgagttcaacctcaagggcttc
tcagaggagggcatcgagctgtacctgaggaagtgccatcgtgagcctggggtggcagat
cgcctcatccacctgctccaaacaacttcagccctgcatggtttgtgtcaccttcctgtc
ttctcgtggatggtgtctaaatgccaccaggaactgttgctgcaggacggggggtcccca
aagaccaccacggatatgtacctgctgatcttgcagcatttcctgcggcatgcctccctc
ccagactcagcctcccagggcctggggcccagcctccttcaaggaaggctccccaccctc
ctgcgcctcggccaactggctctctggggcctgggcatgtgctgctacgtgttctcagcc
cagcagctccaggcagcgcaggttgaccctgatgacatttctctgggcttcctggtgcaa
gcccaaggcgtcgtgccgggaagcacagcgcccctcgaattcctgcacattactttccag
tgctttcttgctgccttctacttggtactcagcactgatgtgccaacagcctccctcaga
tacctcttcaactgtcgcaggcctggcagctcgccgctgtccaggctgctgcccaggctg
tgcgtccagggctcggagcacaaggaaagcaccgtggcggctttgctacagaagactgag
ccgcacaaccttcagatcacagcagccttcctggctggcctgttgtcccgggagcaccgg
gacctgctggctgcgtgccaggcatctgagaggagcttgctccggcgccgggcctgtgcc
cgctggtgtctggcccgcagcctccacaagcacttccggtccatcccaccagccgtgccg
ggggaggccaagagcatgcacgccatgcccgggttcctctggctcatccggagcctgtac
gagatgcaggaggaacggctggcccaggaggctgtgcgcgggctgaatgttgagcacctc
aagctgacgttttgtggcgtgggccctgctgagtgtgccgccctggccttcgtgctgcgc
cacctccggcggcctgtggccctgcagctggaccacaactccgtgggtgacattggtgtg
gagcagctgctgccttgcctcggggcttgcaaggccctctatctgcgagataacaatatc
tcagaccgaggcatttgcaagctcatcgaacatgctcttcactgtgaacaactgcagaag
ttggctctgttcaacaacaagctgaccgatggctgtgcccactccgtggcccagctcctt
gcgtgcaagcagaacttcttggcattgaggctggggaataaccacatcaccgctgaagga
gcccaggtgctggccgaggggctccgagacaacagctccttgcagttcctggggttctgg
ggcaacaaagtgggtgacaagggggcccaggccctggcagaagccttgagtgaccatcaa
agcttgaaatggctcagcctggtggggaacaacattggcagtgtgggtgcccaggcctta
gcatcgatgctggagaagaacgtggcactagaagaactctgcctggaagagaaccatctc
caggatgcaggtgtgtgttctctcgcagaaggactaaagaggaattcaagtttgaaagtc
ttgaagctgtccaacaattgcatcacctttgtgggggcagaagccctcctgcaggccctg
gcaagcaatgacaccatcctggaagtctggctccgcgggaaccctttctctccagaggaa
atggaggcgctcagccacagggacagcagactcttgctgtga

DBGET integrated database retrieval system